Align ABC transporter for D-Alanine, ATPase component (characterized)
to candidate WP_085636165.1 MGEO_RS07775 amino acid ABC transporter ATP-binding protein
Query= reanno::pseudo6_N2E2:Pf6N2E2_5405 (254 letters) >NCBI__GCF_002115805.1:WP_085636165.1 Length = 263 Score = 381 bits (978), Expect = e-111 Identities = 181/245 (73%), Positives = 218/245 (88%) Query: 9 VSPEGIIQMQGVNKWYGQFHVLKDINLNVKQGERIVLCGPSGSGKSTTIRCLNRLEEHQQ 68 VS E +I+++ ++K+YG F VL DI+L V++GERIV+CGPSGSGKST IRCLNRLEEHQ+ Sbjct: 17 VSEEVVIEIEKMSKFYGAFQVLHDIDLQVRRGERIVICGPSGSGKSTLIRCLNRLEEHQE 76 Query: 69 GRIVVDGVELTNDLKQIEAIRREVGMVFQHFNLFPHLTILQNCTLAPMWVRKMPKRKAEE 128 GRIV+DGVELT+DLK I+ +R E+GM FQHFNLFPHLTIL+NCTLAPM R+ P+ +AE Sbjct: 77 GRIVIDGVELTSDLKNIDKVRSEIGMCFQHFNLFPHLTILENCTLAPMLARQTPREEAEA 136 Query: 129 IAMHYLERVRIPEQAHKYPGQLSGGQQQRVAIARALCMKPKIMLFDEPTSALDPEMVKEV 188 AM +LE+V+IP+QA KYPGQLSGGQQQRVAIARALCMKP+IMLFDEPTSALDPEM+KEV Sbjct: 137 TAMRFLEKVKIPDQAGKYPGQLSGGQQQRVAIARALCMKPRIMLFDEPTSALDPEMIKEV 196 Query: 189 LDTMIGLAEDGMTMLCVTHEMGFARTVANRVIFMDKGEIVEQAAPNDFFDNPQNDRTKLF 248 LDTM+ LAE+GMTMLCVTHEMGFA+ VANRVIFMD+G IVE+ P+ FF+NPQN+RT+ F Sbjct: 197 LDTMVELAEEGMTMLCVTHEMGFAQAVANRVIFMDQGRIVEENGPSAFFNNPQNERTQAF 256 Query: 249 LSQIL 253 LSQI+ Sbjct: 257 LSQII 261 Lambda K H 0.322 0.137 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 265 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 263 Length adjustment: 24 Effective length of query: 230 Effective length of database: 239 Effective search space: 54970 Effective search space used: 54970 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory