Align D-xylonate dehydratase subunit (EC 4.2.1.25; EC 4.2.1.82) (characterized)
to candidate WP_085636267.1 MGEO_RS08380 mandelate racemase/muconate lactonizing enzyme family protein
Query= metacyc::MONOMER-18070 (393 letters) >NCBI__GCF_002115805.1:WP_085636267.1 Length = 411 Score = 194 bits (494), Expect = 3e-54 Identities = 122/353 (34%), Positives = 186/353 (52%), Gaps = 22/353 (6%) Query: 28 VRVTTNDGRVGWGET-VSALRAEAVANFVKKI-NTVLKGNDVFNVEKNRLEWYKHDFNMT 85 V+VTT+ G GWGE S++ A+ ++ + + +KG + N+E Y F Sbjct: 26 VKVTTDTGITGWGECYASSVGPTAMKAVIEDVFDRHMKGENPENIELMFRRAYSSGFTQR 85 Query: 86 ISLESTTAYSAVDIASWDIIGKELGAPLYKLLGGKTRDKVLVYA----------NGWYQN 135 L A+S ++IA WDI+GK P++ LLGG+ ++V Y N ++ + Sbjct: 86 PDLTVMGAFSGLEIACWDILGKARNRPVWALLGGRMNERVRAYTYLYPLPHHDLNSFWTD 145 Query: 136 CVKPEDFAEKAKEIVKMGYKALKFDPFGPYF----NDISKKGLDIAEERVKAVREAVGDN 191 P+ AE AKE V+ G+ ALKFDP GPY + + + ++ E KA+R AVGD Sbjct: 146 ---PDAQAEAAKEYVRQGFTALKFDPAGPYTIHGGHQPALTDVSLSVEMCKAIRAAVGDR 202 Query: 192 VDILIEHHGRFNANSAIMIAKRLEKYNPLFMEEPIHPEDVEGLRKYRNNTSLRIALGERI 251 D+L HG+F + AI + + +E Y PL+ EEPI P+++ + + IA GER+ Sbjct: 203 ADLLFGTHGQFTTSGAIRLGQAIEPYLPLWYEEPIPPDNLLEFAEVARAVRIPIATGERM 262 Query: 252 INKQQALYFMKEGLVDFLQADLYRIGGVTETKKVVGIAETFDVQMAFHNAQGPILNAVTL 311 K + ++ G LQ L R GG+ E KK+ +AE F+ +MA H GP+ A + Sbjct: 263 TTKAEFATLLRTGGAKILQPALGRAGGIWEMKKLAAMAEAFNAEMAPHLYAGPVEWAANI 322 Query: 312 QFDAFIPNFLIQESFYDWFPSWKRELIYNGTPIDNGYAIIPERPGLGVEVNEK 364 A IPN LI E+ F + LI N +++GY PE PGLG+E +E+ Sbjct: 323 HLCASIPNVLIAETIETPFHA---ALIRNSIRVEDGYITPPETPGLGIEFDEE 372 Lambda K H 0.319 0.137 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 407 Number of extensions: 17 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 411 Length adjustment: 31 Effective length of query: 362 Effective length of database: 380 Effective search space: 137560 Effective search space used: 137560 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory