Align AotP aka PA0892, component of Arginine/ornithine (but not lysine) porter (characterized)
to candidate WP_085638520.1 MGEO_RS13225 ABC transporter ATP-binding protein
Query= TCDB::O30506 (254 letters) >NCBI__GCF_002115805.1:WP_085638520.1 Length = 264 Score = 339 bits (870), Expect = 3e-98 Identities = 163/249 (65%), Positives = 208/249 (83%) Query: 4 LEVQDLHKRYGSHEVLKGVSLAAKAGDVISIIGSSGSGKSTFLRCINLLEQPHAGKILLN 63 L+VQDLHK YG EVLKGVSL A+ GDVIS++GSSGSGKSTFLRC+NLLE P++G + ++ Sbjct: 14 LQVQDLHKSYGKVEVLKGVSLEARQGDVISMLGSSGSGKSTFLRCLNLLETPNSGTVTVH 73 Query: 64 GEELKLVPGRDGALKAADSRQLQRMRSRLSMVFQHFNLWSHMSALENVIEAPVHVLGVSK 123 GE++K+ R G K +D++Q++R+R+RL+MVFQ FNLWSHM+ LENVI P+HVL + Sbjct: 74 GEDIKMATDRHGVFKPSDAKQVERIRARLAMVFQSFNLWSHMTVLENVIAGPIHVLKQPR 133 Query: 124 KEAIEKAEHYLAKVGVAHRKDAYPAHMSGGEQQRVAIARALAVEPEVMLFDEPTSALDPE 183 EAIEKA+ L +VG+ R+D YP+H+SGG+QQR AIARALA+EPEVMLFDEPTSALDPE Sbjct: 134 AEAIEKAKAVLERVGMYDRRDYYPSHISGGQQQRAAIARALAMEPEVMLFDEPTSALDPE 193 Query: 184 LVGEVLKVMQDLAQEGRTMVVVTHEMGFAREVSNQLVFLHKGLVEEHGCPKEVLANPQSD 243 LVGEVLKV++ LA EGRTM+VVTHEMGFAR+VS++++FLH+GLVEE G P ++ NP S Sbjct: 194 LVGEVLKVIRSLADEGRTMIVVTHEMGFARDVSSEVIFLHQGLVEEQGAPDKMFTNPNSA 253 Query: 244 RLKQFLSGS 252 R K+FLS + Sbjct: 254 RFKEFLSNT 262 Lambda K H 0.317 0.133 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 241 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 264 Length adjustment: 24 Effective length of query: 230 Effective length of database: 240 Effective search space: 55200 Effective search space used: 55200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory