Align Ornithine aminotransferase; Ornithine--oxo-acid aminotransferase; EC 2.6.1.13 (characterized)
to candidate WP_085635112.1 MGEO_RS02575 aspartate aminotransferase family protein
Query= SwissProt::P07991 (424 letters) >NCBI__GCF_002115805.1:WP_085635112.1 Length = 450 Score = 184 bits (467), Expect = 5e-51 Identities = 144/411 (35%), Positives = 210/411 (51%), Gaps = 48/411 (11%) Query: 32 KAKGAHVWDPEGKLYLDFLSAYSAVNQGHCHPHIIKALTEQAQTLTLSSRAFHNDVYAQF 91 KA+G + D G+ ++DF S + G+ HP +++A+ +Q L S R F NDV Sbjct: 55 KAEGIWIEDTSGRRFMDF-HGNSVHHIGYGHPRLVQAVKDQIDALPFSPRRFTNDVSVTL 113 Query: 92 AKFVTEFFG--FETVLPMNTGAEAVETALKLARRWGYMKKNIPQDKAIILGAEGNFHGRT 149 A+ + + VL G++AVE AL+LAR K I A FHG Sbjct: 114 AERLGQIAPGTLNRVLFTTGGSDAVEVALRLARAATGRFKTISFWDA--------FHGAG 165 Query: 150 FGAISLSTDYEDSKLHFGPFVP---NVASGHSVHKIRYGH---------AEDFVPILESP 197 FGA S+ + GP +P +VA H H YGH V + Sbjct: 166 FGASSVGGEATFRSHIAGPLLPGAEHVAPFHCYH-CAYGHPGPETCALACAKMVEFALAR 224 Query: 198 EGKNVAAIILEPIQGEAGIVVPPADYFPKVSALCRKHNVLLIVDEIQTGIGRTGELLCYD 257 EG +VAA+I EP++ A VVPP Y+ V A CRKH LLI+DEI TG+G+TG + +D Sbjct: 225 EG-DVAAVIAEPMR--AVPVVPPPGYWQAVQAACRKHGALLIMDEIPTGLGKTGRMFAFD 281 Query: 258 HYKAEAKPDIVLLGKALSGGVLPVSCVLSSHD--IMSCFTPGSHGSTFGGNPLASRVAIA 315 H E PDIV+LGKAL GG+LP++ +++ D + F G + T NP+ +R A+ Sbjct: 282 HDGIE--PDIVVLGKALGGGMLPIAGIIARDDLNVAGDFAIGHY--THEKNPVTARAALT 337 Query: 316 ALEVIRDEKLCQRAAQLGSSFIAQLKALQAKSNGIISEVRGMGLLTAIVI---------D 366 L++I DE L R+A LG+ +LK + + ++RG GL+ + I D Sbjct: 338 TLDIIEDEGLVDRSATLGAHAQDRLKD-ALHDHPYVGDIRGRGLMFGVEIVTDRDSRTPD 396 Query: 367 PSKANGKTAWDLCLLMKDHGLLAKPTHDHIIRLAPPLVISEEDLQTGVETI 417 P +A + + CL D GL K + ++ L+PPLVISE DL T ++ + Sbjct: 397 PDRA--ERIYYACL---DKGLSFKISAGSVLTLSPPLVISEADLDTALDIV 442 Lambda K H 0.319 0.136 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 507 Number of extensions: 29 Number of successful extensions: 9 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 424 Length of database: 450 Length adjustment: 32 Effective length of query: 392 Effective length of database: 418 Effective search space: 163856 Effective search space used: 163856 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory