Align Glutamate/aspartate import permease protein GltK (characterized)
to candidate WP_085640555.1 MGEO_RS16995 ABC transporter permease subunit
Query= SwissProt::P0AER5 (224 letters) >NCBI__GCF_002115805.1:WP_085640555.1 Length = 404 Score = 75.1 bits (183), Expect = 2e-18 Identities = 42/122 (34%), Positives = 72/122 (59%), Gaps = 1/122 (0%) Query: 97 LISAMVAFSMFEAAYYSEIIRAGIQSISRGQSSAALALGMTHWQSMKLIILPQAFRAMVP 156 LI+ A S++ AA+ +E +RAGI ++S+GQ+ AA +LG+ + M L++LPQA R ++P Sbjct: 272 LIALWFALSIYTAAFIAENVRAGILAVSKGQTEAAASLGLRPGRIMNLVVLPQALRVIIP 331 Query: 157 LLLTQGIVLFQDTSLVYVLSLADFFRTASTIG-ERDGTQVEMILFAGFVYFVISLSASLL 215 L++Q + L +++SL + D T I + G +E I Y ISL+ S + Sbjct: 332 PLISQYLNLTKNSSLAIAVGYMDLTGTLGGITLNQTGRAIEAIFLLMLFYLAISLAISAI 391 Query: 216 VS 217 ++ Sbjct: 392 MN 393 Score = 36.2 bits (82), Expect = 9e-07 Identities = 20/67 (29%), Positives = 36/67 (53%), Gaps = 3/67 (4%) Query: 17 LDGLVITLKITVTAVVIGILWGTMLAVMRLSSFAPVAWFAKAYVNVFRSIPLVMVLLWFY 76 L G++ TL + ++ + G ++ V+RLS V YV +FR++P VL+W Sbjct: 89 LVGVLNTLLVAFLGCLMATVIGVVVGVLRLSDNWLVRQLMSIYVEIFRNVP---VLIWIL 145 Query: 77 LIVPGFL 83 +I+ F+ Sbjct: 146 IIMAVFI 152 Lambda K H 0.330 0.140 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 223 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 3 Number of HSP's successfully gapped: 2 Length of query: 224 Length of database: 404 Length adjustment: 27 Effective length of query: 197 Effective length of database: 377 Effective search space: 74269 Effective search space used: 74269 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory