Align ATPase (characterized, see rationale)
to candidate WP_085636739.1 MGEO_RS10190 amino acid ABC transporter ATP-binding protein
Query= uniprot:Q31RN8 (261 letters) >NCBI__GCF_002115805.1:WP_085636739.1 Length = 256 Score = 233 bits (593), Expect = 4e-66 Identities = 119/240 (49%), Positives = 168/240 (70%), Gaps = 7/240 (2%) Query: 28 EKWYGNQFQALCGVSLTVQRGEVVVMMGPSGSGKSTFLRTLNALESHQRGEIWIEG---- 83 +K +G + L +SL V RG++V ++GPSGSGKST LR +N L++ GE+W++G Sbjct: 14 QKSFGT-LEVLKDISLNVARGQIVAIIGPSGSGKSTLLRAINDLDALTGGEVWLDGVQVN 72 Query: 84 HRLSHDR--RDIATIRQEVGMVFQQFNLFPHLTVLQNLMLAPVQVRRWPVAQAEATARQL 141 +L H + + I +RQ++GMVFQ FNLFPH+T +N+ +AP ++ +A+A A + Sbjct: 73 KKLPHRQYEKHINEMRQQIGMVFQHFNLFPHMTARENVTMAPKMLKGLTAEEADALAEEQ 132 Query: 142 LERVRIAEQADKYPGQLSGGQQQRVAIARALAMQPRILLFDEPTSALDPEMVREVLDVMR 201 L++V + E+ D YP QLSGGQ+QRVAIARALAM+P+++LFDE TSALDPE+V EV VM+ Sbjct: 133 LDKVGMLERIDYYPSQLSGGQKQRVAIARALAMKPKLMLFDEATSALDPELVGEVNQVMK 192 Query: 202 DLASEGMTMLVATHEVGFAREVADRVVLMADGQIVEEAPPDRFFTAPQSDRAKQFLAQIL 261 LA E MTM++ THE+ FA V DRV+ M G +VEE PP++ F PQ DR + FL + L Sbjct: 193 KLAEEHMTMIIVTHEMDFAASVCDRVLFMDQGVVVEEGPPEQVFGNPQKDRTRAFLRKEL 252 Lambda K H 0.321 0.134 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 197 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 256 Length adjustment: 24 Effective length of query: 237 Effective length of database: 232 Effective search space: 54984 Effective search space used: 54984 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory