Align Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale)
to candidate WP_085637119.1 MGEO_RS10860 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= uniprot:A8LLL2 (373 letters) >NCBI__GCF_002115805.1:WP_085637119.1 Length = 350 Score = 321 bits (823), Expect = 2e-92 Identities = 185/355 (52%), Positives = 233/355 (65%), Gaps = 16/355 (4%) Query: 1 MADLKLTGVEKAYGDVKVLSNINLDIQQGELIVFVGPSGCGKSTLLRMIAGLEKITGGTL 60 MA + L ++K++G V+ IN+DI GE IV VGPSGCGKSTLLRM+AGLE +T G + Sbjct: 1 MATVSLKDIKKSFGATDVIHGINMDISDGEFIVIVGPSGCGKSTLLRMVAGLETVTSGEV 60 Query: 61 EIDGTVVNDVPPAQRGIAMVFQSYALYPHMTVRENMSFALKIAKKSQAEIDAAVEAAAEK 120 I G N+ P R IAMVFQ+YALYPHM+VR+NM + LKIA+ + +I+A VE AA+ Sbjct: 61 LIGGQRANEKEPMDRDIAMVFQNYALYPHMSVRQNMGYGLKIARMPKDQINAKVEEAAKL 120 Query: 121 LQLGQYLDRLPKALSGGQRQRVAIGRSIVRDPKVYLFDEPLSNLDAALRVATRLEIAQLK 180 LQL LDR P+ LSGGQRQRVA+GR+IVR+P V+LFDEPLSNLDA LRV RLEI +L+ Sbjct: 121 LQLTPLLDRKPRQLSGGQRQRVAMGRAIVREPAVFLFDEPLSNLDAKLRVQMRLEIKELQ 180 Query: 181 EAMPESTMVYVTHDQVEAMTLATRIVVLAGGGIAQVGSPLELYEKPENEFVAQFIGSPKM 240 + T +YVTHDQVEAMT+A R++V+ GG Q+G+PLE+YE P F AQFIGSP M Sbjct: 181 SKL-GITSLYVTHDQVEAMTMADRMIVMNGGVAEQIGTPLEVYETPRTLFAAQFIGSPAM 239 Query: 241 NLLPGKIIGTGAQTTVEMTDGGRAVSDYPSDDSLMGAAVNVGVRPEDMVEAAPGGDYVFE 300 N+ +I M DG V+ PS + V +G+RPE +V P + F+ Sbjct: 240 NVFDAEIRAGNV-----MIDG---VAITPSAGA--DGPVKLGIRPEHLV---PEENGPFQ 286 Query: 301 GKVAITEALGEVTLLYFEAPSGEDPTIGKLQGIHK-DLKGQVTRLTAEPAKVHVF 354 KV ITE LG TLL+ P GED TI L G+H G R A+P HVF Sbjct: 287 VKVMITEPLGANTLLHGRLPGGEDVTI-SLPGVHNVSATGADMRFAAQPGMTHVF 340 Lambda K H 0.316 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 394 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 373 Length of database: 350 Length adjustment: 29 Effective length of query: 344 Effective length of database: 321 Effective search space: 110424 Effective search space used: 110424 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory