Align 6-P-β-glucosidase (CelF;CelD;LicH;BSU38560) (EC 3.2.1.86) (characterized)
to candidate WP_085638927.1 MGEO_RS13965 alpha-glucosidase/alpha-galactosidase
Query= CAZy::CAA90288.1 (442 letters) >NCBI__GCF_002115805.1:WP_085638927.1 Length = 446 Score = 127 bits (320), Expect = 5e-34 Identities = 123/455 (27%), Positives = 208/455 (45%), Gaps = 42/455 (9%) Query: 6 KIVTIGGGSSYTPELVEGFIKRYDELPVRELWLVDIPEGEEKLNIVGTLAKRMVEKAGVP 65 +I IG GS+ + + G + + L L+DI E++L +A++++ +G Sbjct: 3 RIAFIGAGSTIFMKNIVGDVLHFPALEGATFALMDI--NEQRLEESALVARKLIAASGRS 60 Query: 66 IDIHLTLDRRKALKDADFVTTQFRVGLLQ-ARAKDERIPLKYGV---IGQETNGPGGLFK 121 + T D+R+AL ADFV T F++G + + D IP +YG+ IG +T G GG+ + Sbjct: 61 AQVETTTDQRRALAGADFVVTAFQIGGYEPSTVIDFDIPKQYGLRQTIG-DTLGVGGIMR 119 Query: 122 GLRTIPVILEIAKDIEELCPNAWLVNFTNPAGMVTEALLRYSNLKKVVGLCNVPIGIKMG 181 GLRT+P + +A D+ ELCP+A L+ + NP + T A+ K VGLC+ Sbjct: 120 GLRTVPHLWRVAADMAELCPDATLLQYVNPMAINTWAIAESYPGVKQVGLCHSVQNTVEE 179 Query: 182 VAKALDVDVDRVEVQFAGLNHMVFGLDVFLDGVSVKEQVIEA--MGD-PKNAMTMKNISG 238 +A LD+ + + AG+NH+ F LD+ G S+ + E +G PK + M + Sbjct: 180 LAHDLDLPKGEIRYRVAGVNHVAFFLDLTHKGKSLYPALREGYRVGSLPKPPLLMPRCAN 239 Query: 239 -AEWEPDFLKALNVIPCGYHRYYFKTKEMLEHELEASQ--TEGTRAEVVQKVEKELFELY 295 +E H YF T E EH E + R +++ L E Sbjct: 240 KVRYE-----------VMEHLGYFCT-ESSEHLAEYVPWFIKSGREDLIDAFSVPLDEYP 287 Query: 296 K----------DPNLAIK-PPQLEKRGGAYYSDAACNLISSIYNDKHDIQPVNTINNGAI 344 K D A + Q++ R ++ N + + N + I N N G Sbjct: 288 KRCIEQMADWADQAKAYRTADQIDFRKSHEFAAEIMN--AMVTNQPYTIYG-NLSNRGQA 344 Query: 345 ASIPDDSAVEVNCVMTKTGPKPIAVGDLPVSVRGLVQQIKSFERVAAEAAVTGDYQTALL 404 +P +AVEV C++ G +P + D+P + L++ + + + A V D + Sbjct: 345 PQLPSGAAVEVPCMVDANGIQPTVIDDIPPQLVALMRTQINVQELVVRALVDEDIEHVYH 404 Query: 405 AMTINPLVPSDTVAKQI---LDEMLEAHKAYLPQF 436 A ++P ++ +QI + ++L AH LP+F Sbjct: 405 AAMMDPHTAAELDLRQIRSLVTDLLAAHGDMLPEF 439 Lambda K H 0.318 0.137 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 401 Number of extensions: 27 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 442 Length of database: 446 Length adjustment: 32 Effective length of query: 410 Effective length of database: 414 Effective search space: 169740 Effective search space used: 169740 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory