Align CbtD, component of Cellobiose and cellooligosaccharide porter (characterized)
to candidate WP_085636091.1 MGEO_RS07450 dipeptide/oligopeptide/nickel ABC transporter permease/ATP-binding protein
Query= TCDB::Q97VF5 (362 letters) >NCBI__GCF_002115805.1:WP_085636091.1 Length = 628 Score = 178 bits (452), Expect = 3e-49 Identities = 105/299 (35%), Positives = 165/299 (55%), Gaps = 5/299 (1%) Query: 61 RIIKAVNDVSFGVEKGEILGIIGESGSGKTTLISAILRAIR-PPGKIISGKVIFNGMDIF 119 R+ +AV V VE GE LGIIGESGSGK+ +I+ + PPG I G + G D+ Sbjct: 318 RVYRAVGGVDLHVEPGECLGIIGESGSGKSVTALSIMGLVASPPGVITGGAAYYRGDDLI 377 Query: 120 SMTIDEFRKLLWKDISYVPQASQNALNPVLPISEIFYHEAISHGEADKKRVIERASELLK 179 + R L + ++Y+ Q L+P+ + + +H + RA LLK Sbjct: 378 GAPYEVLRSLRGRHVAYIFQDPLATLHPLYTVGDQLIEAVRAHHPTPRAEARVRAISLLK 437 Query: 180 LVGLDPARV-LKMYPFQLSGGMKQRVMIALSLLLNPKLILMDEPTSALDMLNQELLLKLI 238 V + A + YP ++SGGM+QRV IA++L +P +I+ DEPT+ALD+ Q +L L+ Sbjct: 438 SVRIPNAEQRIDSYPHEMSGGMRQRVGIAMALANDPDIIIADEPTTALDVTVQAQILSLL 497 Query: 239 KNINQEMGVTIVYVTHDILNIAQIANRLLVMYKGYVMEEGKTEEIIKSPLNPYTSLLVSS 298 ++ +E G+ I+++THD +AQ+ +R+ VMY G ++E G T+ I+ +P +PYTS L++ Sbjct: 498 NDLRRERGLAIIFITHDFGVVAQLCDRVAVMYAGRIVEGGPTDTILNAPAHPYTSRLMAC 557 Query: 299 IPSL-KGEVKVINVPLDEPLVSK-EKGCPFLARCSKAFGRCK-EELPEIRLVYDRKVRC 354 +P L +G + +P P V GC F RC K C+ ++P +VRC Sbjct: 558 VPELGQGRRVLAAIPGLPPAVDNLPTGCAFADRCHKVQPACRTADIPLSGPSDGNRVRC 616 Lambda K H 0.319 0.138 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 404 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 628 Length adjustment: 33 Effective length of query: 329 Effective length of database: 595 Effective search space: 195755 Effective search space used: 195755 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory