Align MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized)
to candidate WP_085635144.1 MGEO_RS02745 ATP-binding cassette domain-containing protein
Query= TCDB::P96483 (377 letters) >NCBI__GCF_002115805.1:WP_085635144.1 Length = 334 Score = 311 bits (796), Expect = 2e-89 Identities = 171/352 (48%), Positives = 218/352 (61%), Gaps = 39/352 (11%) Query: 17 DKPAVDQLDIAIEDGEFLVLVGPSGCGKSTSLRMLAGLEDVNGGAIRIGDRDVTHLPPKD 76 D + LD+ IEDGEF V VGPSGCGKST LR++AGLED+ G I I D T+L P Sbjct: 15 DIQVIPPLDLTIEDGEFTVFVGPSGCGKSTLLRLIAGLEDITTGTIEIDGNDATNLVPAK 74 Query: 77 RDIAMVFQNYALYPHMTVADNMGFALKIAGVPKAEIRQKVEEAAKILDLTQYLDRKPKAL 136 R +AMVFQ+YALYPHM+V N+ F LK+A + AEI +++E AA +L+LT YLDR+P L Sbjct: 75 RGLAMVFQSYALYPHMSVRKNIAFPLKMAKMDPAEIDKRIEAAASVLNLTAYLDRRPGQL 134 Query: 137 SGGQRQRVAMGRAIVREPQVFLMDEPLSNLDAKLRVSTRTQIASLQRRLGITTVYVTHDQ 196 SGGQRQRVA+GRAIVREP FL DEPLSNLDA LRV R +I+ L +RL T +YVTHDQ Sbjct: 135 SGGQRQRVAIGRAIVREPAAFLFDEPLSNLDAALRVGMRLEISELHKRLATTMIYVTHDQ 194 Query: 197 VEAMTMGDRVAVLKDGLLQQVDSPRNMYDKPANLFVAGFIGSPAMNLVEVPITDGGVKFG 256 VEAMTM D++ VL+ G+++QV SP +Y +P N FVAGFIGSP MNL+ Sbjct: 195 VEAMTMADKIVVLQAGVIEQVGSPLELYQRPRNTFVAGFIGSPKMNLI------------ 242 Query: 257 NSVVPVNREALSAADKGDRTVTVGVRPEHFDVVELGGAVAASLSKDSADAPAGLAVSVNV 316 + + A K D T+G+RPEH D+ E GA + V Sbjct: 243 ---------SGAEAQKHD-AATIGIRPEHIDISESSGAWKG---------------KIGV 277 Query: 317 VEELGADGYVYGTAEVGGEVKDLVVRVNGRQVPEKGSTLHVVPRPGETHVFS 368 E LG+D + + +V E L VR G + GS +++ PRP H F+ Sbjct: 278 SEHLGSDTFFHVQCDVTDE--PLTVRATGEVSFKYGSEVYLTPRPEHLHRFN 327 Lambda K H 0.317 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 331 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 334 Length adjustment: 29 Effective length of query: 348 Effective length of database: 305 Effective search space: 106140 Effective search space used: 106140 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory