Align GDP-6-deoxy-D-talose 4-dehydrogenase (EC 1.1.1.135); 3-hydroxy-2-methylbutyryl-CoA dehydrogenase (EC 1.1.1.178) (characterized)
to candidate WP_085639334.1 MGEO_RS14675 SDR family oxidoreductase
Query= BRENDA::Q99714 (261 letters) >NCBI__GCF_002115805.1:WP_085639334.1 Length = 255 Score = 272 bits (695), Expect = 6e-78 Identities = 147/254 (57%), Positives = 178/254 (70%), Gaps = 5/254 (1%) Query: 9 KGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSE 68 K VA+++GGASGLG A A L GA VLLD+ + G AQAK LG +F DV+ Sbjct: 5 KDTVAIVSGGASGLGAAAATALAEAGAKLVLLDMNETAGAAQAKALGG--IFVKTDVSDP 62 Query: 69 KDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNV 128 V A+ K +G +AVNCAGIA A+KT + KG H + F + VNL+GTFNV Sbjct: 63 ASVAAAMETVKTTYGTAHIAVNCAGIAPAAKT--VSKGAAHDPKPFIATIKVNLIGTFNV 120 Query: 129 IRLVAGEMGQNEP-DQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLA 187 A M N+P D G RGVI+NTASVAA+EGQVGQ AY+ASKGG+VGMTLP+ARDLA Sbjct: 121 ASQAAALMAANDPLDADGSRGVIVNTASVAAYEGQVGQVAYAASKGGVVGMTLPMARDLA 180 Query: 188 PIGIRVMTIAPGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLN 247 +GIRV IAPGLF TP+L LP++V + L +QVPFPSRLG+P+EYA LV+ I+EN LN Sbjct: 181 QLGIRVCAIAPGLFKTPMLEGLPQEVQDSLGAQVPFPSRLGNPSEYAQLVRHIVENQMLN 240 Query: 248 GEVIRLDGAIRMQP 261 GEVIRLDGAIRM P Sbjct: 241 GEVIRLDGAIRMAP 254 Lambda K H 0.318 0.135 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 248 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 255 Length adjustment: 24 Effective length of query: 237 Effective length of database: 231 Effective search space: 54747 Effective search space used: 54747 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory