Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate WP_085635671.1 MGEO_RS05250 ABC transporter ATP-binding protein
Query= uniprot:Q1MCU3 (247 letters) >NCBI__GCF_002115805.1:WP_085635671.1 Length = 384 Score = 193 bits (490), Expect = 5e-54 Identities = 104/236 (44%), Positives = 151/236 (63%), Gaps = 3/236 (1%) Query: 11 LLQVNGVETYYGNIRALAGVDVHVNKGEIVSLIGANGAGKSTLMMTICGSPQART-GSVV 69 +L+V + YG RAL G + V KGEIV ++GANGAGKSTL+ ICG + G V Sbjct: 1 MLEVRNLSVSYGKHRALDGASLRVGKGEIVVILGANGAGKSTLLKAICGICEGHVAGQVS 60 Query: 70 FEGRDITRMPTHEIARLRIAQSPEGRRIFPRMTVLENLQMGAGLDNLK-HFAEDVEKIFT 128 + ++ H I IA PEGR +F +TV ENL +GA + + A +++++ + Sbjct: 61 LQNAELVGEKPHRIVEAGIALVPEGRGVFGDLTVEENLTLGAYAERARDEEAGNLQRVLS 120 Query: 129 LFPRLKERHAQRGGTLSGGEQQMLSIGRALMARPKLLLLDEPSLGLAPLIVKGIFEAIRK 188 LFP+L+ER Q T+SGGEQQM++IGRA+M+ P +L LDEPSLGL+PL+ K +FE++R Sbjct: 121 LFPKLQERRKQTVRTMSGGEQQMVAIGRAMMSNPSILALDEPSLGLSPLLCKDLFESLRV 180 Query: 189 LNEAEGLTVFLVEQNAFAALRLSHRAYVMVNGKVTMSGSGKELLANPEVRAAYLEG 244 + +A GL + LVEQNA +LR++ R Y++ NG + + L +P V+ AYL G Sbjct: 181 VKQA-GLGILLVEQNAKQSLRIADRGYLLENGTIVHEDDAERLANDPAVQKAYLGG 235 Lambda K H 0.320 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 271 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 384 Length adjustment: 27 Effective length of query: 220 Effective length of database: 357 Effective search space: 78540 Effective search space used: 78540 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory