Align ABC transporter for Glycerol, ATPase component 2 (characterized)
to candidate WP_085635144.1 MGEO_RS02745 ATP-binding cassette domain-containing protein
Query= reanno::acidovorax_3H11:Ac3H11_792 (358 letters) >NCBI__GCF_002115805.1:WP_085635144.1 Length = 334 Score = 196 bits (497), Expect = 1e-54 Identities = 116/333 (34%), Positives = 183/333 (54%), Gaps = 24/333 (7%) Query: 26 PLKMEFEDGGAYALLGPSGCGKTTMLNIMSGLLVPSHGKVLFDGRDVTRASPQERNIAQV 85 PL + EDG +GPSGCGK+T+L +++GL + G + DG D T P +R +A V Sbjct: 21 PLDLTIEDGEFTVFVGPSGCGKSTLLRLIAGLEDITTGTIEIDGNDATNLVPAKRGLAMV 80 Query: 86 FQFPVIYDTMTVAENLAFPLRNRKVPEGQIKQRVGVIAEMLEMSGQLNQRAAGLAADAKQ 145 FQ +Y M+V +N+AFPL+ K+ +I +R+ A +L ++ L++R L+ +Q Sbjct: 81 FQSYALYPHMSVRKNIAFPLKMAKMDPAEIDKRIEAAASVLNLTAYLDRRPGQLSGGQRQ 140 Query: 146 KISLGRGLVRADVAAVLFDEPLTVIDPHLKWQLRRKLKQIHHELKLTLIYVTHDQVEALT 205 ++++GR +VR + AA LFDEPL+ +D L+ +R ++ ++H L T+IYVTHDQVEA+T Sbjct: 141 RVAIGRAIVR-EPAAFLFDEPLSNLDAALRVGMRLEISELHKRLATTMIYVTHDQVEAMT 199 Query: 206 FADQVVVMTRGKAVQVGSADALFERPAHTFVGHFIGSPGMNFLPAHRDGENLSVAGHRLA 265 AD++VV+ G QVGS L++RP +TFV FIGSP MN + Sbjct: 200 MADKIVVLQAGVIEQVGSPLELYQRPRNTFVAGFIGSPKMNLISG--------------- 244 Query: 266 SPVGRALPAGALQVGIRPEYLALAQPQQAGALPGTVVQVQDIG--TYQMLTAKVGEHTVK 323 A A +GIRPE++ ++ + +GA G + + +G T+ + V + + Sbjct: 245 ---AEAQKHDAATIGIRPEHIDIS--ESSGAWKGKIGVSEHLGSDTFFHVQCDVTDEPLT 299 Query: 324 ARFTPETRLPSSGDTAWLQVLGEHTCYYKNEEL 356 R T E G +L EH + + L Sbjct: 300 VRATGEVSF-KYGSEVYLTPRPEHLHRFNEQGL 331 Lambda K H 0.320 0.136 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 291 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 334 Length adjustment: 29 Effective length of query: 329 Effective length of database: 305 Effective search space: 100345 Effective search space used: 100345 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory