Align ABC transporter for Glycerol, ATPase component 2 (characterized)
to candidate WP_085637757.1 MGEO_RS11955 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= reanno::acidovorax_3H11:Ac3H11_792 (358 letters) >NCBI__GCF_002115805.1:WP_085637757.1 Length = 365 Score = 206 bits (523), Expect = 1e-57 Identities = 122/337 (36%), Positives = 190/337 (56%), Gaps = 17/337 (5%) Query: 6 LDLAHSYKPNPQQDSDYALLPLKMEFEDGGAYALLGPSGCGKTTMLNIMSGLLVPSHGKV 65 LD+ + YK + L + + E G L+GPSGCGK+T+LN ++GL + G + Sbjct: 5 LDIKNLYK---SYGTTEILKDINVSIEPGDFLVLVGPSGCGKSTLLNCIAGLEPITGGSI 61 Query: 66 LFDGRDVTRASPQERNIAQVFQFPVIYDTMTVAENLAFPLRNRKVPEGQIKQRVGVIAEM 125 G+D+T SP++R+IA VFQ +Y TMTVA+N+ F ++ R V + +++ +A+ Sbjct: 62 NIGGKDMTHVSPKDRDIAMVFQSYALYPTMTVAKNITFGMKVRGVDQATQDRKLAQVAQQ 121 Query: 126 LEMSGQLNQRAAGLAADAKQKISLGRGLVRADVAAVLFDEPLTVIDPHLKWQLRRKLKQI 185 L++ LN+R L+ +Q++++GR LVR D LFDEPL+ +D L+ ++R ++K + Sbjct: 122 LQIEPLLNRRPGQLSGGQRQRVAMGRALVR-DPKLFLFDEPLSNLDAKLRVEMRTEIKSL 180 Query: 186 HHELKLTLIYVTHDQVEALTFADQVVVMTRGKAVQVGSADALFERPAHTFVGHFIGSPGM 245 HH L +++YVTHDQ+EA+T A ++VVM G Q+GS ++ RPA+ FV F+GSP M Sbjct: 181 HHNLGASMVYVTHDQIEAMTLATKIVVMKGGVIQQIGSPAEIYNRPANLFVADFMGSPAM 240 Query: 246 NFLP--AHRDGENLSVAGHR-------LASPVGRALPAGALQVGIRPEYLA---LAQPQQ 293 N +P AHR E + R L R LP + +G+RPE +A L + Sbjct: 241 NLIPAKAHRADEGTRIEITRKSGEPIVLTDTKNRDLPEDVI-LGVRPEDIADPDLRGAEA 299 Query: 294 AGALPGTVVQVQDIGTYQMLTAKVGEHTVKARFTPET 330 A A + V+ G ++G V AR ET Sbjct: 300 AQAAECLIDMVEPAGADTFAVMQLGGKHVTARLHAET 336 Lambda K H 0.320 0.136 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 312 Number of extensions: 18 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 365 Length adjustment: 29 Effective length of query: 329 Effective length of database: 336 Effective search space: 110544 Effective search space used: 110544 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory