Align BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized)
to candidate WP_085636165.1 MGEO_RS07775 amino acid ABC transporter ATP-binding protein
Query= TCDB::P73721 (252 letters) >NCBI__GCF_002115805.1:WP_085636165.1 Length = 263 Score = 255 bits (652), Expect = 6e-73 Identities = 130/242 (53%), Positives = 173/242 (71%), Gaps = 3/242 (1%) Query: 8 LISFDQLQKNFGALQVLRGVTGEIYPKDVISIIGPSGCGKSTFLRCLNRLEPISGGRLEV 67 +I +++ K +GA QVL + ++ + I I GPSG GKST +RCLNRLE GR+ + Sbjct: 22 VIEIEKMSKFYGAFQVLHDIDLQVRRGERIVICGPSGSGKSTLIRCLNRLEEHQEGRIVI 81 Query: 68 AGVDLSGAKIDQKHLRQLRVRVGMVFQHFNLFPHLTVLQNLLLAPRKVLRIPMAEAKDRA 127 GV+L+ D K++ ++R +GM FQHFNLFPHLT+L+N LAP + P EA+ A Sbjct: 82 DGVELTS---DLKNIDKVRSEIGMCFQHFNLFPHLTILENCTLAPMLARQTPREEAEATA 138 Query: 128 LTYLDKVGLGTKADNYPDQLSGGQKQRVAIARGLCMKPEILLFDEPTSALDPELVGEVLN 187 + +L+KV + +A YP QLSGGQ+QRVAIAR LCMKP I+LFDEPTSALDPE++ EVL+ Sbjct: 139 MRFLEKVKIPDQAGKYPGQLSGGQQQRVAIARALCMKPRIMLFDEPTSALDPEMIKEVLD 198 Query: 188 VMKQLAEEGMTMAVVTHEMQFAREVSNRVFFFNQGIIEEEGDPNEVFRNPKSDRLRAFLS 247 M +LAEEGMTM VTHEM FA+ V+NRV F +QG I EE P+ F NP+++R +AFLS Sbjct: 199 TMVELAEEGMTMLCVTHEMGFAQAVANRVIFMDQGRIVEENGPSAFFNNPQNERTQAFLS 258 Query: 248 RI 249 +I Sbjct: 259 QI 260 Lambda K H 0.321 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 194 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 252 Length of database: 263 Length adjustment: 24 Effective length of query: 228 Effective length of database: 239 Effective search space: 54492 Effective search space used: 54492 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory