Align NatA aka BRAF aka SLR0467, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate WP_085640649.1 MGEO_RS17175 ABC transporter ATP-binding protein
Query= TCDB::Q55164 (267 letters) >NCBI__GCF_002115805.1:WP_085640649.1 Length = 251 Score = 161 bits (407), Expect = 1e-44 Identities = 100/257 (38%), Positives = 149/257 (57%), Gaps = 16/257 (6%) Query: 18 LLLAQGLSKSFGGLRAVDHADIVVKEGSITGLIGPNGAGKTTLFNLLSNFIRPDQGEVLF 77 LL + ++K FGGL+A+ + ++ V E + +IGPNGAGK+TL N L + PD G V+F Sbjct: 3 LLEVKDVNKRFGGLQALGNVNLSVAENTCHAIIGPNGAGKSTLLNCLVGKLIPDTGSVMF 62 Query: 78 NGDSIGQLAPHQIALRGSVRTFQVAKVLSRLTVLENMLLADQHQTGEKFLPRLINFRRVQ 137 +G S+ P +I G R FQ ++ LTV+ENML+ + F L R V Sbjct: 63 DGQSVLGRTPFEINQMGISRVFQTPEIFGDLTVMENMLIPCFAKRDGSF--ALHGIRSVL 120 Query: 138 KEERANREKAMAMLESVGLGAKAQDYAGALSGGQRKLLEMARALMSNPKLILLDEPAAGV 197 E R++A ML+ V + K ++ ++S G ++ LEMA L+ NPKL+LLDEP AG+ Sbjct: 121 SEGEL-RDQAEQMLDDVNMLDKRNMHSASMSRGDKRRLEMAMCLVQNPKLLLLDEPTAGM 179 Query: 198 -----NPT--LIGQICEHIVNWNRQGITFLVIEHNMDVIMTLCHHVWVLAEGRNLADGTP 250 N T L+ +I E ++ IT +IEH+M V+ +L + VLA+G L + TP Sbjct: 180 ARADTNNTIDLLKEIKE------KRDITIAIIEHDMHVVFSLAERITVLAQGTPLVEDTP 233 Query: 251 EQIQSDPRVLEAYLGDS 267 E I+ P+V EAYLG++ Sbjct: 234 ENIKGHPKVKEAYLGEA 250 Lambda K H 0.319 0.136 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 183 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 251 Length adjustment: 24 Effective length of query: 243 Effective length of database: 227 Effective search space: 55161 Effective search space used: 55161 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory