Align ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized)
to candidate WP_085637119.1 MGEO_RS10860 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= reanno::Smeli:SMc03065 (362 letters) >NCBI__GCF_002115805.1:WP_085637119.1 Length = 350 Score = 341 bits (875), Expect = 2e-98 Identities = 189/355 (53%), Positives = 238/355 (67%), Gaps = 15/355 (4%) Query: 1 MTGLLLKDIRKSYGAVDVIHGIDLDIKEGEFVVFVGPSGCGKSTLLRMIAGLEEITGGDM 60 M + LKDI+KS+GA DVIHGI++DI +GEF+V VGPSGCGKSTLLRM+AGLE +T G++ Sbjct: 1 MATVSLKDIKKSFGATDVIHGINMDISDGEFIVIVGPSGCGKSTLLRMVAGLETVTSGEV 60 Query: 61 FIDGERVNDVPPSKRGIAMVFQSYALYPHMTVYDNMAFGMRIARESKEEIDRRVRGAADM 120 I G+R N+ P R IAMVFQ+YALYPHM+V NM +G++IAR K++I+ +V AA + Sbjct: 61 LIGGQRANEKEPMDRDIAMVFQNYALYPHMSVRQNMGYGLKIARMPKDQINAKVEEAAKL 120 Query: 121 LQLTPYLDRLPKALSGGQRQRVAIGRAICRNPKVFLFDEPLSNLDAALRVATRIEIAKLS 180 LQLTP LDR P+ LSGGQRQRVA+GRAI R P VFLFDEPLSNLDA LRV R+EI +L Sbjct: 121 LQLTPLLDRKPRQLSGGQRQRVAMGRAIVREPAVFLFDEPLSNLDAKLRVQMRLEIKELQ 180 Query: 181 ERMSDTTMIYVTHDQVEAMTLADRIVVLSAGHIEQVGAPLELYERPANLFVARFIGSPAM 240 ++ T +YVTHDQVEAMT+ADR++V++ G EQ+G PLE+YE P LF A+FIGSPAM Sbjct: 181 SKLG-ITSLYVTHDQVEAMTMADRMIVMNGGVAEQIGTPLEVYETPRTLFAAQFIGSPAM 239 Query: 241 NVIPATITATGQQTAVSLAGGKSVTLDVPTNASENGKTASFGVRPEDLRVTEADDFLFEG 300 NV A I A G +A S D P G+RPE L ++ F+ Sbjct: 240 NVFDAEIRA-GNVMIDGVAITPSAGADGP---------VKLGIRPEHL--VPEENGPFQV 287 Query: 301 TVSIVEALGEVTLLYIEGLVENEPIIAKMPGIARV-GRGDKVRFTADKAKLHLFD 354 V I E LG TLL+ L E + +PG+ V G +RF A H+FD Sbjct: 288 KVMITEPLGANTLLH-GRLPGGEDVTISLPGVHNVSATGADMRFAAQPGMTHVFD 341 Lambda K H 0.320 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 376 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 350 Length adjustment: 29 Effective length of query: 333 Effective length of database: 321 Effective search space: 106893 Effective search space used: 106893 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory