Align TM1749, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized)
to candidate WP_085636091.1 MGEO_RS07450 dipeptide/oligopeptide/nickel ABC transporter permease/ATP-binding protein
Query= TCDB::Q9X271 (324 letters) >NCBI__GCF_002115805.1:WP_085636091.1 Length = 628 Score = 277 bits (708), Expect = 6e-79 Identities = 144/314 (45%), Positives = 199/314 (63%), Gaps = 1/314 (0%) Query: 4 LLNVNNLKVEFHRVEGIVKAVDGISYKLNKGESLGIVGESGSGKSVSVLSLLRLI-NRNG 62 LL++ L+ +F + + +AV G+ + GE LGI+GESGSGKSV+ LS++ L+ + G Sbjct: 303 LLSITALETQFRVKDRVYRAVGGVDLHVEPGECLGIIGESGSGKSVTALSIMGLVASPPG 362 Query: 63 RIVDGEAIFLGKDLLKLNKEELRNIRGKDISIIFQNPMTSLNPIIRVGIQVMEPIIWHRL 122 I G A + G DL+ E LR++RG+ ++ IFQ+P+ +L+P+ VG Q++E + H Sbjct: 363 VITGGAAYYRGDDLIGAPYEVLRSLRGRHVAYIFQDPLATLHPLYTVGDQLIEAVRAHHP 422 Query: 123 MKNEEARERAIELLERVGIPESPKRFLNYPFQFSGGMRQRVMIAMALACHPKLLIADEPT 182 EAR RAI LL+ V IP + +R +YP + SGGMRQRV IAMALA P ++IADEPT Sbjct: 423 TPRAEARVRAISLLKSVRIPNAEQRIDSYPHEMSGGMRQRVGIAMALANDPDIIIADEPT 482 Query: 183 TALDVTIQAQIMELLQELKEEYGMSVIFITHDLSVATNFCDRIITMYAGKIVEEAPVEEI 242 TALDVT+QAQI+ LL +L+ E G+++IFITHD V CDR+ MYAG+IVE P + I Sbjct: 483 TALDVTVQAQILSLLNDLRRERGLAIIFITHDFGVVAQLCDRVAVMYAGRIVEGGPTDTI 542 Query: 243 LKTPLHPYTKGLLNSTLEIGSRGKKLVPIPGNPPNPTKHPSGCKFHPRCSFAMEICQREE 302 L P HPYT L+ E+G + L IPG PP P+GC F RC C+ + Sbjct: 543 LNAPAHPYTSRLMACVPELGQGRRVLAAIPGLPPAVDNLPTGCAFADRCHKVQPACRTAD 602 Query: 303 PPLVNISENHRVAC 316 PL S+ +RV C Sbjct: 603 IPLSGPSDGNRVRC 616 Lambda K H 0.320 0.139 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 422 Number of extensions: 14 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 628 Length adjustment: 33 Effective length of query: 291 Effective length of database: 595 Effective search space: 173145 Effective search space used: 173145 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory