Align cyclohexa-1,5-dienecarbonyl-CoA hydratase (EC 4.2.1.100) (characterized)
to candidate WP_106299206.1 MGEO_RS14005 crotonobetainyl-CoA hydratase
Query= BRENDA::O87873 (258 letters) >NCBI__GCF_002115805.1:WP_106299206.1 Length = 261 Score = 109 bits (272), Expect = 7e-29 Identities = 89/267 (33%), Positives = 126/267 (47%), Gaps = 23/267 (8%) Query: 6 SPLKVWLERDGSLLRLRLARPKANIVDAAMIAAMRQALGEHLQAPALRAVLLDAEG---- 61 SPL V RDG +L + L RPKAN +D AM + P LR ++ G Sbjct: 4 SPLNV--TRDGHVLEVVLNRPKANAIDLQTSRAMGEVFRSFRDDPELRVAIITGGGDKFF 61 Query: 62 -PHFSFGASVDEHMPDQCAQMLKSLHGLVREMLDSPVPILVALRGQCLGGGLEVAAAGNL 120 P + A+ D D G ++E+ D P++ A+ G C GGGLE+A + ++ Sbjct: 62 CPGWDLKAAADGDAVD--GDYGVGGFGGLQELRDLNKPVIAAVNGICCGGGLELALSADI 119 Query: 121 LFAAPDAKFGQPEIRLGVFAPAASCLLPPRVGQACAEDLLWSGRSIDGAEGHRIGLID-- 178 + AA A F PEIR G A AAS LP R+ A ++L +GR +D E R G ++ Sbjct: 120 ILAADHASFALPEIRSGTVADAASVKLPKRIPYHIAMEMLLTGRWLDVEEAARWGFVNHI 179 Query: 179 -----VLAEDPEAAALRWFDEHIARLSASSL-RFAVRAARCDSVPRI-KQKLDTVEALYL 231 ++ E AAL + + + R A D + RI K++L TV+ LY Sbjct: 180 HPADTLMTEARSMAALLASGPPLVYAAIKEIVREAEDTGFQDMMNRITKRQLATVDVLY- 238 Query: 232 EELMASHDAVEGLKAFLEKRSANWENR 258 AS D EG +AF EKR W+ R Sbjct: 239 ----ASEDQQEGARAFAEKRDPVWKGR 261 Lambda K H 0.321 0.135 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 149 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 261 Length adjustment: 24 Effective length of query: 234 Effective length of database: 237 Effective search space: 55458 Effective search space used: 55458 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory