Align ABC-type branched-chain amino acid transport system, ATPase component protein (characterized, see rationale)
to candidate WP_085640649.1 MGEO_RS17175 ABC transporter ATP-binding protein
Query= uniprot:D8J1T6 (255 letters) >NCBI__GCF_002115805.1:WP_085640649.1 Length = 251 Score = 179 bits (455), Expect = 4e-50 Identities = 97/250 (38%), Positives = 150/250 (60%), Gaps = 6/250 (2%) Query: 5 LLKIRDVSKRFGGLQALNGVGITIERGQIYGLIGPNGAGKTTFFNVITGLYQPDTGTFEL 64 LL+++DV+KRFGGLQAL V +++ + +IGPNGAGK+T N + G PDTG+ Sbjct: 3 LLEVKDVNKRFGGLQALGNVNLSVAENTCHAIIGPNGAGKSTLLNCLVGKLIPDTGSVMF 62 Query: 65 DGKPYSPSAPHEVAKAGIARTFQNIRLFGEMTVLENVMVGCHVRTKQNVFGAVFRHKAAR 124 DG+ P E+ + GI+R FQ +FG++TV+EN+++ C + G+ H Sbjct: 63 DGQSVLGRTPFEINQMGISRVFQTPEIFGDLTVMENMLIPCFAKRD----GSFALHGIRS 118 Query: 125 E-EEAAIREKSQKLLDFVGIGQFAKRTARHLSYGDQRRLEIARALATDPQLLALDEPAAG 183 E +R++++++LD V + + +S GD+RRLE+A L +P+LL LDEP AG Sbjct: 119 VLSEGELRDQAEQMLDDVNMLDKRNMHSASMSRGDKRRLEMAMCLVQNPKLLLLDEPTAG 178 Query: 184 MNATEKLGLRELLVKIQAEGK-TILLIEHDVKLMMGLCNRITVLDYGKPIAEGVPADVQK 242 M + +LL +I+ + TI +IEHD+ ++ L RITVL G P+ E P +++ Sbjct: 179 MARADTNNTIDLLKEIKEKRDITIAIIEHDMHVVFSLAERITVLAQGTPLVEDTPENIKG 238 Query: 243 NPAVIEAYLG 252 +P V EAYLG Sbjct: 239 HPKVKEAYLG 248 Lambda K H 0.320 0.138 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 170 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 251 Length adjustment: 24 Effective length of query: 231 Effective length of database: 227 Effective search space: 52437 Effective search space used: 52437 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory