Align 5-aminovalerate transaminase (EC 2.6.1.48) (characterized)
to candidate WP_085635152.1 MGEO_RS02785 diaminobutyrate--2-oxoglutarate transaminase
Query= BRENDA::Q88RB9 (425 letters) >NCBI__GCF_002115805.1:WP_085635152.1 Length = 430 Score = 189 bits (480), Expect = 1e-52 Identities = 143/422 (33%), Positives = 208/422 (49%), Gaps = 29/422 (6%) Query: 7 SLMQRRVAAVPRGVGQIHPIFVDTAKNSTVIDVEGRELIDFAGGIAVLNTGHLHPKVVAA 66 S+ +RR +A R + P TA+ S + D G+ IDF G + LN GH P + AA Sbjct: 10 SIFERRESAA-RSYCRGMPATFATAQGSEITDEAGKTWIDFLAGCSSLNYGHNDPDMKAA 68 Query: 67 VQEQLTKVS-------HTCFQVLAYEPYVELCEKINKLVPGDFDKKTLLV-TTGSEAVEN 118 + E ++ HT + E + + + L P D D + + TG+ AVE Sbjct: 69 LIEHISNDGLAHGLDLHTDTKAAFLEAF-----ESHILEPRDMDHRVMFTGPTGANAVEA 123 Query: 119 AVKIARAATGRAGVIAFTGGYHGRTMMTLGLTGKVVPYSAGMGLMPGGIFRALFPSELHG 178 A+KIAR TGR +IAFT G+HG T L TG + G G G+ R F + G Sbjct: 124 AMKIARKVTGRTNIIAFTNGFHGVTTGALSATGNGY-HRGGAGTSLNGVTRMPFDNYFPG 182 Query: 179 ISVDDAIASVERIFKNDAEPRDI-AAIILEPVQGEGGFLPAPKELMKRLRALCDQHGILL 237 + + +E + K+ + D AAI+LE VQGEGG A E ++ + L +G LL Sbjct: 183 ET--NTAEFLEAMLKDQSGGVDAPAAILLETVQGEGGLNAASPEWVRHIAKLAKDNGALL 240 Query: 238 IADEVQTGAGRTGTFFAMEQMGVAPDLTTFAKSIAG-GFPLAGVCGKAEYMDAIAPGGLG 296 I D++Q G GR GTFF+ E MGV PD+ T AKS++G G P+A V K +Y D P Sbjct: 241 IIDDIQAGCGRCGTFFSFEDMGVTPDIVTMAKSVSGFGLPMAMVLVKPDY-DIFGPAEHN 299 Query: 297 GTYAGSPIACAAALAVIEVFEEEKLLDRSKAVGERLT-AGLREIQKKYPIIGDVRGLGSM 355 GT+ G+ A A IE F R + ++ L ++ P ++G G M Sbjct: 300 GTFRGNTHAFVTARVAIEKFWSNDAFQRELSEKAQIVHDALADLAAMVP-DAHLKGRGLM 358 Query: 356 IAVEVFEKGTHTPNAAAVGQVVAKAREKGLILLSCGTYGNVLRILVPLTAEDALLDKGLA 415 V+V + ++ A+A EKGLI+ + G+ V+++L PLT L KGL Sbjct: 359 QGVDVI-------SGDLASEICARAYEKGLIIETSGSEDQVIKVLAPLTTPTDTLRKGLN 411 Query: 416 II 417 I+ Sbjct: 412 IL 413 Lambda K H 0.320 0.138 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 479 Number of extensions: 26 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 425 Length of database: 430 Length adjustment: 32 Effective length of query: 393 Effective length of database: 398 Effective search space: 156414 Effective search space used: 156414 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory