Align L-serine ammonia-lyase (EC 4.3.1.17); D-Serine ammonia-lyase (EC 4.3.1.18) (characterized)
to candidate WP_085641172.1 MGEO_RS18545 D-cysteine desulfhydrase
Query= BRENDA::O57809 (325 letters) >NCBI__GCF_002115805.1:WP_085641172.1 Length = 341 Score = 203 bits (517), Expect = 4e-57 Identities = 132/325 (40%), Positives = 175/325 (53%), Gaps = 18/325 (5%) Query: 10 AKFPRVELIPWETPIQYLPNISREIGAD-VYIKRDDLTGLGIGGNKIRKLEYLLGDALSK 68 ++FPRV L T ++ + +S+E+G ++IKRDD TG+ GGNK RKLE+L+ +A ++ Sbjct: 4 SRFPRVNLAHLPTALEPMDRLSKELGGPRIWIKRDDCTGMSTGGNKTRKLEFLMAEAQAQ 63 Query: 69 GADVVITVGAVHSNHAFVTGLAAKKLGLDAILVLRGKE-------ELKGNYLLDKIMGIE 121 GAD+VIT GA SNHA T A KLG+D ++L + L GN LD + G Sbjct: 64 GADLVITQGATQSNHARQTAACAAKLGMDCHILLEDRTGSNDPNYNLNGNVFLDFLHG-A 122 Query: 122 TRVYDAKDSFELMKYAEEIAEELKREGRKPYVIPPGGASPIGTLGYVRAVGEIATQSE-- 179 T ++ E +AE+ + EGR Y IP GG++P G LGY A E+ TQ+ Sbjct: 123 TAEKRPGTGLDMNAAMEVVAEKFRAEGRNVYTIPGGGSNPTGALGYANAAMELVTQANNM 182 Query: 180 -VKFDSIVVAAGSGGTLAGLSLGLSILNEDIRPVGIAVGRFGEVMTSKLDNLIKEAAELL 238 +K D IV A GS GT AGL +GL +N +I +GI V + NL + AE L Sbjct: 183 GLKIDRIVHATGSAGTQAGLVVGLKAINANIPLLGIGVRAPKPKQEENVYNLAVKTAEKL 242 Query: 239 GVKVEVRPE----LYDYSFGEYGKITGEVAQIIRKVGTREGIILDPVYTGKAFYGLVDLA 294 G V E DY YG T E I EGI+LDPVY+GK GL+DL Sbjct: 243 GCPGVVSREDVEANTDYVGEGYGIPTKEGLAAIEMFARLEGILLDPVYSGKGAAGLIDLI 302 Query: 295 RKGELG--EKILFIHTGGISGTFHY 317 RKG E I+F+HTGG F Y Sbjct: 303 RKGAFAGDENIVFVHTGGGVALFGY 327 Lambda K H 0.319 0.142 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 273 Number of extensions: 15 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 325 Length of database: 341 Length adjustment: 28 Effective length of query: 297 Effective length of database: 313 Effective search space: 92961 Effective search space used: 92961 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory