Align AraV, component of Arabinose, fructose, xylose porter (characterized)
to candidate WP_085637119.1 MGEO_RS10860 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= TCDB::Q97UF2 (371 letters) >NCBI__GCF_002115805.1:WP_085637119.1 Length = 350 Score = 197 bits (500), Expect = 5e-55 Identities = 123/370 (33%), Positives = 201/370 (54%), Gaps = 25/370 (6%) Query: 1 MTTIRVENLSKIFKKGKTEVKAVDNVSITIDSGMAFGVLGPSGHGKTTFLRLIAGLEEPT 60 M T+ ++++ K F G T+V + +++ I G ++GPSG GK+T LR++AGLE T Sbjct: 1 MATVSLKDIKKSF--GATDV--IHGINMDISDGEFIVIVGPSGCGKSTLLRMVAGLETVT 56 Query: 61 SGYIYFDNEAVSSPRRVMMSPEKRGIAMVFQNWALYPNMTVFDNIAFPLKLAKVPKDKIE 120 SG + + + P R IAMVFQN+ALYP+M+V N+ + LK+A++PKD+I Sbjct: 57 SGEVLIGGQRANEKE-----PMDRDIAMVFQNYALYPHMSVRQNMGYGLKIARMPKDQIN 111 Query: 121 NKVKEVSEELGLSGVLNRYPKELSGGQMQRTAIARALVKDPKVLLLDEPFSNLDAQIRES 180 KV+E ++ L L+ +L+R P++LSGGQ QR A+ RA+V++P V L DEP SNLDA++R Sbjct: 112 AKVEEAAKLLQLTPLLDRKPRQLSGGQRQRVAMGRAIVREPAVFLFDEPLSNLDAKLRVQ 171 Query: 181 ARALVRKIQRERKLTTLIVSHDPADIFAIANKAGVIVNGKFAQIGTPTEIYEYPATDLIA 240 R ++++Q + +T+L V+HD + +A++ V+ G QIGTP E+YE P T A Sbjct: 172 MRLEIKELQSKLGITSLYVTHDQVEAMTMADRMIVMNGGVAEQIGTPLEVYETPRTLFAA 231 Query: 241 RLTGE--INLIQAKIIENNAIIANLKVPLNNMELKGQSNIVIGLRPDDLTLSDTLLDKYI 298 + G +N+ A+I N +I + + + +G+RP+ L + Sbjct: 232 QFIGSPAMNVFDAEIRAGNVMIDGVAI---TPSAGADGPVKLGIRPEHLVPEEN------ 282 Query: 299 DMGIVKVKLV---SYGAGIFKIVVSPITDENIDIIVDAEEPLETGIETHLLAKPNKVKIF 355 G +VK++ GA P ++ + TG + A+P +F Sbjct: 283 --GPFQVKVMITEPLGANTLLHGRLPGGEDVTISLPGVHNVSATGADMRFAAQPGMTHVF 340 Query: 356 DLNGSNLITS 365 D ++S Sbjct: 341 DATSGMRLSS 350 Lambda K H 0.317 0.136 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 301 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 371 Length of database: 350 Length adjustment: 29 Effective length of query: 342 Effective length of database: 321 Effective search space: 109782 Effective search space used: 109782 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory