Align subunit of β-ketoadipyl CoA thiolase (EC 2.3.1.174; EC 2.3.1.16) (characterized)
to candidate WP_085640001.1 MGEO_RS15830 acetyl-CoA C-acyltransferase
Query= metacyc::MONOMER-3207 (400 letters) >NCBI__GCF_002115805.1:WP_085640001.1 Length = 390 Score = 229 bits (584), Expect = 1e-64 Identities = 158/405 (39%), Positives = 216/405 (53%), Gaps = 32/405 (7%) Query: 1 MRDVFICDAIRTPIGR-FGGALAGVRADDLAAVPLKALIEPNPAVQWDQVDEVFFGCANQ 59 M+ I A RT + + F GAL + + L+ + D++++V GC Sbjct: 1 MKQAVIVAAGRTGLAKSFRGALNQTHGATMTGHVIAELMR-RTGLGADEIEDVVIGCGYP 59 Query: 60 AGEDNRNVARMALLLAGLPESIPGVTLNRLCASGMDAIGTAFRAIASGEMELAIAGGVES 119 E N+AR + L AG+ + T++R CASG+ A+ TA AI + + IAGGVES Sbjct: 60 EAETGGNIARQSALRAGVSKVSAAQTVSRFCASGLQAVATAAHAIVADDAGPQIAGGVES 119 Query: 120 MSRAPFVMGKAESGYSRNMKLEDTTIGWRFINPLMKSQYGVDSMPETADNVADDYQVSRA 179 +S + K ++ + T+ M +M ETAD VA+ Y + R Sbjct: 120 IS---LIQPKIR-------RVPEPTLAAGMPELYM-------TMIETADLVAERYGIDRD 162 Query: 180 DQDAFALRSQQKAAAAQAAGFFAEEIVP--VRIAHKKGET--------IVERDEHLRPET 229 QDAF L SQQ+ A AQ AG FA+EI+P +A + ET ++RDE RP+T Sbjct: 163 RQDAFGLLSQQRTAKAQEAGLFADEIIPFDTMMAIEDRETGEVSEKAVTLDRDECNRPDT 222 Query: 230 TLEALTKLKPVNGPDKTVTAGNASGVNDGAAALILASAEAVKKHGLTPRARVLGMASGGV 289 TL+ L L V VTAGNAS ++DGAAALIL A ++ L P G A G Sbjct: 223 TLDGLRSLSTVR-EGGYVTAGNASQLSDGAAALILMEASEAERRNLEPLGAFRGFAVAGC 281 Query: 290 APRVMGIGPVPAVRKLTERLGVAVSDFDVIELNEAFASQGLAVLRELGVADDAPQVNPNG 349 P MGIGPV AV +L ER G+ V D D+ ELNEAFASQ L LG+ D ++N NG Sbjct: 282 GPEEMGIGPVFAVPRLLERHGLTVDDIDLWELNEAFASQALYCRDRLGI--DPEKLNVNG 339 Query: 350 GAIALGHPLGMSGARLVLTALHQLEKSGGRKGLATMCVGVGQGLA 394 G+I++GHP GM+GARL L++ + G + G+ TMCV G G A Sbjct: 340 GSISIGHPFGMTGARLTGHLLYEGRRRGAKLGVVTMCVAGGMGAA 384 Lambda K H 0.318 0.134 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 430 Number of extensions: 21 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 390 Length adjustment: 31 Effective length of query: 369 Effective length of database: 359 Effective search space: 132471 Effective search space used: 132471 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory