Align 2-aminomuconate 6-semialdehyde dehydrogenase (EC 1.2.1.32) (characterized)
to candidate WP_085637847.1 MGEO_RS12055 aldehyde dehydrogenase family protein
Query= metacyc::MONOMER-13361 (500 letters) >NCBI__GCF_002115805.1:WP_085637847.1 Length = 474 Score = 294 bits (753), Expect = 4e-84 Identities = 175/472 (37%), Positives = 266/472 (56%), Gaps = 17/472 (3%) Query: 23 YIDGNFVTSAS--SFANINPVNGKLISDVFEADAKQVNEAVVAAQNALKGPWGKLSVQDR 80 Y++G +V + F I+P N ++I+ + + V+ AV AA A W +V +R Sbjct: 8 YVNGAWVDPVAYRDFEVIHPGNEEVIATIALGSSSDVDHAVAAATEAFN-TWQFSTVDER 66 Query: 81 AALIHKIADGIQARFEEFVAAEVADTGRPVHQARTLDIPRAIANFRTFADLAKTSHTDLF 140 AL+ ++ + R E F+ + G + +R + +P I + + K F Sbjct: 67 VALLERMIIAYEKRSEAFIKVMSQEIGTTLSFSREVQMPVGIGHLEAAIEALKAHQ---F 123 Query: 141 EMSTSDGSGALNYTVRKPLGVIGVISPWNLPLLLFTWKVAPALACGNTVVAKPSEESPSS 200 E + G L + +P+GV+G+I+PWN P+ KVAPALA G T+V KPSE SP S Sbjct: 124 ERPSLRGGSTL---IDEPVGVVGMITPWNWPVNQIMIKVAPALAAGCTIVLKPSEYSPLS 180 Query: 201 ATLLAEVMHDAGVPPGVFNLIHGFGKDSAGEFLTQHPGISALTFTGESKTGSTIMKAVAD 260 A +LAEV+ +AG PPGVFNL++G G GE ++ HPGI ++FTG ++ G + K+ A+ Sbjct: 181 AIMLAEVIDEAGCPPGVFNLVNGDGP-GVGEAISAHPGIHMVSFTGSTRAGKLVTKSAAN 239 Query: 261 GVKEVSFELGGKNAAVVFADADLDAAIEGVLRSSFTNSGQVCLCSERVYVHRSIFDEFVS 320 +K V+ ELGGK+ + FADADLDAA + + F N+GQ C + R+ V R I+DE V Sbjct: 240 SIKRVTLELGGKSPNLFFADADLDAAARISVDACFINNGQSCDAASRLLVERKIYDEVVE 299 Query: 321 GLKVEAERLVVGYPDQDGVNMGPLISHGHRDKVLSYYRLAVDEGATVVTGG-GVPK-FND 378 + E V P ++G ++GP+++ + V ++ +D+GA + GG G P FN Sbjct: 300 RVTQIVENTKVDDPMKEGSHIGPVVNKKQFEHVQRLIQVGIDDGARLAAGGLGRPAGFN- 358 Query: 379 ERDQGAYVQPTIWTGLSDKARCVTEEIFGPVCHISPFDDEDEVINRVNDSNYGLACAIWT 438 +G Y++PT++ +++ +E+FGPV I PFD E+E I ND+ YGLA I + Sbjct: 359 ---KGYYIRPTLFADVTNDMEIAQQEVFGPVLAILPFDTEEEAIEIANDTPYGLAAYIQS 415 Query: 439 TNLSRAHRVSRQIHVGLVWVNTWYLRDLRTPFGGVKLSGLGREGGRFSMDFY 490 T+ R HRVSR++ G++ VN + D PFGG K SG GRE G Y Sbjct: 416 TDQERIHRVSRKLRAGVISVN-GKVGDYDVPFGGYKESGNGREAGPMGFHEY 466 Lambda K H 0.318 0.135 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 542 Number of extensions: 31 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 500 Length of database: 474 Length adjustment: 34 Effective length of query: 466 Effective length of database: 440 Effective search space: 205040 Effective search space used: 205040 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory