Align Metapyrocatechase; MPC; EC 1.13.11.2; CatO2ase; Catechol 2,3-dioxygenase (uncharacterized)
to candidate WP_085635682.1 MGEO_RS05310 catechol 2,3-dioxygenase
Query= curated2:P31003 (327 letters) >NCBI__GCF_002115805.1:WP_085635682.1 Length = 318 Score = 249 bits (636), Expect = 6e-71 Identities = 128/314 (40%), Positives = 191/314 (60%), Gaps = 4/314 (1%) Query: 7 EPIFDVAQLAHVELLSPKLEESIVFFTKYLGMEVTARAGNSVYLRAYEDFYHNTLKITES 66 EP FDVA L HVE+L+ K +ES+ FFT+ G++++A G+S YLRA++D+ +++K+T+S Sbjct: 3 EPCFDVAHLGHVEVLTNKFDESLDFFTRVYGLKLSALEGDSAYLRAWDDYEFHSMKLTKS 62 Query: 67 AEAGLGHVGWRASSPQALERRVLELEKSGL-GRGWIDGDIGHGKAYQFTTPDGHQMEIFF 125 G+ H+G+R SS ALERRV +E SG GW++GD+GHG+AY+F P GH E+++ Sbjct: 63 DTTGVAHIGYRMSSEAALERRVKAIEASGYKTHGWVEGDLGHGRAYRFEDPFGHVFELYW 122 Query: 126 EVEYYKPQPEQKTKLLNRPSKRPAQGVPVRRLDHINLMTSNPGVDTQFMIDTLGFRLREQ 185 + Y P PE + L N S+ AQGV RR+DH+NL+ + FM LG R+ EQ Sbjct: 123 DTVKYDPPPEDRPALKNMSSRFHAQGVSPRRIDHLNLLAEDVTQFRDFMQTCLGSRVTEQ 182 Query: 186 IR-DKGKILGSWISVSNLVHEIAFMQEPNQEKGKLHHLCYWYGIPQNLYDLADLLKDHEY 244 IR + G++ G W +++N +++A +E + +LHH+ Y +++ AD+ ++ Sbjct: 183 IRLNNGRLGGCWFTINNKTYDLACTEEHGRGSNRLHHVTYATDQREDILRAADIFLENGV 242 Query: 245 FIEVPPNKHGISQAFCMYVYEPGGNRIELFGDAGYLITDPTWEPVIWEMEDVPGNGDTWI 304 IE P+KH I F +YV+EP GNRIEL LI P WE V W ED G W Sbjct: 243 HIETGPHKHAIQGTFFLYVWEPAGNRIELANAGARLILQPDWETVTW-TEDERKKGQAW- 300 Query: 305 GTAFPDSWWLRGTP 318 G +++ GTP Sbjct: 301 GLKTIETFHTHGTP 314 Lambda K H 0.319 0.138 0.437 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 361 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 327 Length of database: 318 Length adjustment: 28 Effective length of query: 299 Effective length of database: 290 Effective search space: 86710 Effective search space used: 86710 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory