Align ABC transporter for Xylitol, ATPase component (characterized)
to candidate WP_085637757.1 MGEO_RS11955 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= reanno::Dino:3607124 (338 letters) >NCBI__GCF_002115805.1:WP_085637757.1 Length = 365 Score = 313 bits (801), Expect = 6e-90 Identities = 172/357 (48%), Positives = 232/357 (64%), Gaps = 34/357 (9%) Query: 4 IKIDKINKFYGTTQALFDINLDIEDGEFVVFVGPSGCGKSTLLRTLAGLEGVSSGRIEIG 63 + I + K YGTT+ L DIN+ IE G+F+V VGPSGCGKSTLL +AGLE ++ G I IG Sbjct: 5 LDIKNLYKSYGTTEILKDINVSIEPGDFLVLVGPSGCGKSTLLNCIAGLEPITGGSINIG 64 Query: 64 GRDVTTVEPADRDLAMVFQSYALYPHMTVRENMEFGMKVNGFEPDLRKERIAEAARVLQL 123 G+D+T V P DRD+AMVFQSYALYP MTV +N+ FGMKV G + + ++A+ A+ LQ+ Sbjct: 65 GKDMTHVSPKDRDIAMVFQSYALYPTMTVAKNITFGMKVRGVDQATQDRKLAQVAQQLQI 124 Query: 124 EDYLDRKPGQLSGGQRQRVAIGRAIVKNPSVFLFDEPLSNLDAKLRVQMRVELEGLHKQL 183 E L+R+PGQLSGGQRQRVA+GRA+V++P +FLFDEPLSNLDAKLRV+MR E++ LH L Sbjct: 125 EPLLNRRPGQLSGGQRQRVAMGRALVRDPKLFLFDEPLSNLDAKLRVEMRTEIKSLHHNL 184 Query: 184 GATMIYVTHDQVEAMTMADKIVVLNRGRIEQVGSPMDLYHKPNSRFVAEFIGSPAMN--- 240 GA+M+YVTHDQ+EAMT+A KIVV+ G I+Q+GSP ++Y++P + FVA+F+GSPAMN Sbjct: 185 GASMVYVTHDQIEAMTLATKIVVMKGGVIQQIGSPAEIYNRPANLFVADFMGSPAMNLIP 244 Query: 241 ---------------------VFSSDVGLQDISLDASAAFVGCRPEHIEIVPDGDGHIAA 279 + +D +D+ D +G RPE I PD G AA Sbjct: 245 AKAHRADEGTRIEITRKSGEPIVLTDTKNRDLPED---VILGVRPEDI-ADPDLRGAEAA 300 Query: 280 -----TVHVKERLGGESLLYLGLKGGGQIVARVGGDDETKVGAAVSLRFSRHRLHQF 331 + + E G ++ + L GG + AR+ + K G L F ++ F Sbjct: 301 QAAECLIDMVEPAGADTFAVMQL-GGKHVTARLHAETTAKPGQPKRLSFDLGKVSYF 356 Lambda K H 0.320 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 376 Number of extensions: 15 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 365 Length adjustment: 29 Effective length of query: 309 Effective length of database: 336 Effective search space: 103824 Effective search space used: 103824 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory