Align ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized)
to candidate WP_085637119.1 MGEO_RS10860 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= reanno::WCS417:GFF4321 (386 letters) >NCBI__GCF_002115805.1:WP_085637119.1 Length = 350 Score = 313 bits (803), Expect = 4e-90 Identities = 169/369 (45%), Positives = 233/369 (63%), Gaps = 21/369 (5%) Query: 1 MATLELRNVNKTYGAGLPDTLKNIELSIKEGEFLILVGPSGCGKSTLMNCIAGLETITGG 60 MAT+ L+++ K++GA D + I + I +GEF+++VGPSGCGKSTL+ +AGLET+T G Sbjct: 1 MATVSLKDIKKSFGA--TDVIHGINMDISDGEFIVIVGPSGCGKSTLLRMVAGLETVTSG 58 Query: 61 AIMIGDQDVSGMSPKDRDIAMVFQSYALYPTMSVRENIEFGLKIRKMPQADIDAEVARVA 120 ++IG Q + P DRDIAMVFQ+YALYP MSVR+N+ +GLKI +MP+ I+A+V A Sbjct: 59 EVLIGGQRANEKEPMDRDIAMVFQNYALYPHMSVRQNMGYGLKIARMPKDQINAKVEEAA 118 Query: 121 KLLQIEHLLNRKPGQLSGGQQQRVAMGRALARRPKIYLFDEPLSNLDAKLRVEMRTEMKL 180 KLLQ+ LL+RKP QLSGGQ+QRVAMGRA+ R P ++LFDEPLSNLDAKLRV+MR E+K Sbjct: 119 KLLQLTPLLDRKPRQLSGGQRQRVAMGRAIVREPAVFLFDEPLSNLDAKLRVQMRLEIKE 178 Query: 181 MHQRLKTTTVYVTHDQIEAMTLGDKVAVMKDGIIQQFGTPKEIYNNPANQFVASFIGSPP 240 + +L T++YVTHDQ+EAMT+ D++ VM G+ +Q GTP E+Y P F A FIGSP Sbjct: 179 LQSKLGITSLYVTHDQVEAMTMADRMIVMNGGVAEQIGTPLEVYETPRTLFAAQFIGSPA 238 Query: 241 MNFVPLRLQRKDGRLVALLDSGQARCELALNTTEAGLEDRDVILGLRPEQIMLAAGEGDS 300 MN ++ +G + T AG D V LG+RPE ++ + Sbjct: 239 MNVFDAEIR-----------AGNVMIDGVAITPSAG-ADGPVKLGIRPEHLV-----PEE 281 Query: 301 ASSIRAEVQVTEPTGPDTLVFVQLNDTKVCCRLAPDV--APQVGETLTLQFDPSKVLLFD 358 + +V +TEP G +TL+ +L + P V G + P +FD Sbjct: 282 NGPFQVKVMITEPLGANTLLHGRLPGGEDVTISLPGVHNVSATGADMRFAAQPGMTHVFD 341 Query: 359 ANTGERLGT 367 A +G RL + Sbjct: 342 ATSGMRLSS 350 Lambda K H 0.318 0.135 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 374 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 386 Length of database: 350 Length adjustment: 30 Effective length of query: 356 Effective length of database: 320 Effective search space: 113920 Effective search space used: 113920 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory