Align Glyoxylate reductase; EC 1.1.1.26 (characterized)
to candidate WP_085635223.1 MGEO_RS00570 D-glycerate dehydrogenase
Query= SwissProt::Q9C4M5 (331 letters) >NCBI__GCF_002115805.1:WP_085635223.1 Length = 316 Score = 229 bits (583), Expect = 9e-65 Identities = 133/322 (41%), Positives = 193/322 (59%), Gaps = 13/322 (4%) Query: 5 VFITRQIPENGIKMIEKFYEIELWKDPKAP-PRGVLLEKVREVDALVTLVTDKVDKELLE 63 + ITR++P+ + + +++ + +D AP R L++ + D ++ + D ++ + Sbjct: 3 LLITRKLPDPVLNKAREVFDVTV-RDNTAPLSREELIQSLSAYDVVLPTLGDAYRADIFD 61 Query: 64 NAP--KLKIIAQYAVGYDNIDIEEATKRGIYVTNTPGVLTDATADLAFALLLAVARRIVE 121 P + K++A + VGY++ID A GI VTNTPG +TDATAD+A L+L RR E Sbjct: 62 AVPEKRTKLLANFGVGYNHIDAAAARAAGIEVTNTPGAVTDATADIALTLMLMTCRRAGE 121 Query: 122 ADAFVRSGEWKKSEVGWHPLMFLGYGLKGKTLGIVGFGRIGQALAKRAK-GFGMKIIYYS 180 + VR+G W+ GWHP LG + GKTLG+VG GRIGQA+A+RA GFGM + YY+ Sbjct: 122 GERLVRAGRWE----GWHPTQLLGLHMSGKTLGVVGMGRIGQAIARRAHFGFGMAVKYYN 177 Query: 181 RTRKPEAEEEIGAEYV-DFETLLKESDFISLHVPLTKETYHMIGEKELKLMKPNAILINT 239 R+ + E + AE V + L + D + + VP ET+H+I L M+P+A L+N Sbjct: 178 RSPR---EMQFPAEQVPNLTDLAAQVDVMVVAVPGGAETHHLIDAAVLTAMQPHAHLVNI 234 Query: 240 SRGAVVDTNALIKALKEGWIAGAGLDVFEEEPYYNEELFKLKNVVLAPHIGSATHEAREG 299 +RG VV+ LI AL EG IAGAGLDV+E EP + L ++NV L PH+G+A E R Sbjct: 235 ARGDVVNEADLIAALSEGRIAGAGLDVYEFEPKVPQALIDMENVTLLPHLGTAALEVRTA 294 Query: 300 MAELVAKNLIAFAKGEIPPNLV 321 M + N IAFAKG+ PN V Sbjct: 295 MGLMAVDNAIAFAKGQALPNAV 316 Lambda K H 0.317 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 261 Number of extensions: 11 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 316 Length adjustment: 28 Effective length of query: 303 Effective length of database: 288 Effective search space: 87264 Effective search space used: 87264 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory