Align TM1749, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized)
to candidate WP_087506007.1 CBE68_RS10355 ATP-binding cassette domain-containing protein
Query= TCDB::Q9X271 (324 letters) >NCBI__GCF_002165625.1:WP_087506007.1 Length = 263 Score = 139 bits (351), Expect = 6e-38 Identities = 81/263 (30%), Positives = 147/263 (55%), Gaps = 15/263 (5%) Query: 4 LLNVNNLKVEFHRVEGI-----VKAVDGISYKLNKGESLGIVGESGSGKSVSVLSLLRLI 58 LL V ++ + +G V+A+ +S+ L + +L +VGE+GSGKS +L R++ Sbjct: 5 LLQVKHISKTYQNSKGWFRNEKVQAIKSVSFDLKRAHTLAVVGEAGSGKS----TLARIL 60 Query: 59 NRNGRIVDGEAIFLGKDLLKLNKEELRNIRGKDISIIFQNPMTSLNPIIRVGIQVMEPII 118 G+ + G++L N+ + R DI +I Q P SLNP +RVG+Q++ P++ Sbjct: 61 AGEMAPSAGDILLHGQNLNDTNQRQ----RCMDIRMIPQRPSLSLNPRLRVGMQILAPLV 116 Query: 119 WHRLMKNEEARERAIELLERVGIPESPKRFLNYPFQFSGGMRQRVMIAMALACHPKLLIA 178 HR + +++ + VG+ E + YP S R RV +A A+ P++L+ Sbjct: 117 QHRSLTRSLRQQKLYATMRDVGLLEEHADY--YPNMLSASQRLRVTLARAMIVDPEVLVF 174 Query: 179 DEPTTALDVTIQAQIMELLQELKEEYGMSVIFITHDLSVATNFCDRIITMYAGKIVEEAP 238 D+ +A+D+T++AQ++ LL L++ GM+ I I H LS+ + D ++ M G+++E +P Sbjct: 175 DQTLSAMDITMRAQLINLLTMLQQSRGMAYIMIGHQLSMIRHLADDVMVMQQGEVIEFSP 234 Query: 239 VEEILKTPLHPYTKGLLNSTLEI 261 +EI ++P YT+ L+ + E+ Sbjct: 235 TDEIFESPASEYTQRLIYAYNEL 257 Lambda K H 0.320 0.139 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 166 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 263 Length adjustment: 26 Effective length of query: 298 Effective length of database: 237 Effective search space: 70626 Effective search space used: 70626 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory