Align TM1749, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized)
to candidate WP_087506008.1 CBE68_RS10360 ATP-binding cassette domain-containing protein
Query= TCDB::Q9X271 (324 letters) >NCBI__GCF_002165625.1:WP_087506008.1 Length = 338 Score = 208 bits (529), Expect = 2e-58 Identities = 114/325 (35%), Positives = 185/325 (56%), Gaps = 15/325 (4%) Query: 2 MELLNVNNLKVEFHRVEGIVKAVDGISYKLNKGESLGIVGESGSGKSVSVLSLLRLINRN 61 M LL++ NL +E +GI+ AV+ S + GE GIVGESGSGKS+ +++ L++ Sbjct: 1 MNLLDIRNLTIELETPQGIITAVERFSLVVQDGEFRGIVGESGSGKSLVGRAIMGLLSNK 60 Query: 62 GRIVDGEAIFLGKDLLKLNKEELRNIRGKDISIIFQNPMTSLNPIIRVGIQVMEPI---- 117 R+ F G+DL +++ +E R G++ ++IFQ P + L+PI ++G Q++E + Sbjct: 61 WRVRADRFFFAGEDLQQMDVDEHRRFMGREAAMIFQQPSSYLDPIAKIGEQILEALPQTP 120 Query: 118 -----IWHRLMKNEEARERAIELLERVGIPESPKRFLNYPFQFSGGMRQRVMIAMALACH 172 W R N + E+ LL +VGI + + +YP + S G+ Q++MIAMA+A Sbjct: 121 RLNLAFWRR---NSDRLEKVSALLHKVGIRDHKRIMASYPHELSEGLCQKIMIAMAIANE 177 Query: 173 PKLLIADEPTTALDVTIQAQIMELLQELKEEYGMSVIFITHDLSVATNFCDRIITMYAGK 232 P+LLIADEPT+ ++ T + QI +L+ ++ + +SV+ I ++L A N+ DR+ MY G+ Sbjct: 178 PRLLIADEPTSTMEATTKIQIYKLMAKMNQLRKLSVVHICNELETAANWTDRVTIMYCGQ 237 Query: 233 IVEEAPVEEILKTPLHPYTKGLLNSTLEIGSRGKKLVPIPGNPPNPTKHPSGCKFHPRCS 292 VE P +++++ PLHPYT L + ++ + L +PG P P+GC+ PRC Sbjct: 238 SVEAGPTQQVVEQPLHPYTHALA-TLIKRDPERQMLNVMPGTMPTLQHLPTGCRLGPRCP 296 Query: 293 FAMEICQREEPPLVNISENHRVACH 317 A + C E P N CH Sbjct: 297 RAHKDC--IEMPRSRYLRNRSYRCH 319 Lambda K H 0.320 0.139 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 247 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 338 Length adjustment: 28 Effective length of query: 296 Effective length of database: 310 Effective search space: 91760 Effective search space used: 91760 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory