Align TM1750, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized)
to candidate WP_087506594.1 CBE68_RS13315 ABC transporter ATP-binding protein
Query= TCDB::Q9X272 (328 letters) >NCBI__GCF_002165625.1:WP_087506594.1 Length = 350 Score = 121 bits (304), Expect = 2e-32 Identities = 78/252 (30%), Positives = 138/252 (54%), Gaps = 7/252 (2%) Query: 31 KAVDGISIEIKEGETLGLVGESGCGKSTLGRTILKLLRPDGGKIFFEGKDITNLNDKEMK 90 + +D IS+ GE L+G SGCGKSTL + I L++PD G I GK++++ + + Sbjct: 21 QVLDCISLNQLTGEINCLLGPSGCGKSTLLKLIAGLIKPDSGTISMAGKELSSKRNV-IA 79 Query: 91 PYRKKMQIIFQDPLGSLNPQMTVGRIIEDPLIIHKIGTKKERRKRVEELLDMVGIGREFI 150 P ++++ ++FQD +L P +TV I L K+++++R+++LL+++G+ + Sbjct: 80 PEQRQIGMVFQDL--ALFPHLTVAENICFGLYQQP---KQQQQQRLQQLLELIGLTAK-A 133 Query: 151 NSFPHEFSGGQQQRIGIARALALNPKFIVCDEPVSALDVSIQAQIIDLLEEIQQKMGISY 210 +P SGGQQQR+ +ARALA PK ++ DEP S D +++ ++ L +I + GI+ Sbjct: 134 EQYPSALSGGQQQRVALARALAPKPKLLLLDEPFSGFDSHLKSTLVPELRQILKHEGITS 193 Query: 211 LFIAHNLAVVEHISHKVAVMYLGKIVEYGDVDKIFLNPIHPYTRALLKSVPKIPWDGQKQ 270 L + H+ ++ +VAVM G++ +Y +I+ P + + S I Sbjct: 194 LIVTHDQHEAFALADRVAVMNDGQVHQYDTPQQIYRCPASAFVARFIGSGQLIAGKVTAT 253 Query: 271 RFYSLKGELPSP 282 + G LP P Sbjct: 254 AIETALGTLPLP 265 Lambda K H 0.321 0.142 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 283 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 350 Length adjustment: 28 Effective length of query: 300 Effective length of database: 322 Effective search space: 96600 Effective search space used: 96600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory