Align L-iditol 2-dehydrogenase (EC 1.1.1.14) (characterized)
to candidate WP_087506848.1 CBE68_RS14645 fructuronate reductase
Query= BRENDA::Q9KWR5 (485 letters) >NCBI__GCF_002165625.1:WP_087506848.1 Length = 492 Score = 237 bits (605), Expect = 6e-67 Identities = 133/381 (34%), Positives = 207/381 (54%), Gaps = 7/381 (1%) Query: 3 TRETLKSLPANVQAPPYDIDGIKPGIVHFGVGNFFRAHEAFYVEQILEHAPD-WAIVGVG 61 T L+SL N + +D ++ IVH G G F R H+A Y + + + W I + Sbjct: 5 TEVNLESLGFN-EKTSFDRSKLETNIVHIGFGAFHRGHQAVYNDLTNDQSDKLWGICEIN 63 Query: 62 LTGSDRSKKKAEEFKAQDCLYSLTETAPSGKSTVRVMGALRDYLLAPADP-EAVLKHLVD 120 + G + + +AQ L+S+ E + + R++ ++ + + P D +A + L + Sbjct: 64 MFGGP---ELIADLQAQQHLFSVVERSADSMVS-RLIRSVTESIHTPVDGIQAAIDKLAE 119 Query: 121 PAIRIVSMTITEGGYNINETTGAFDLENAAVKADLKNPEKPSTVFGYVVEALRRRWDAGG 180 P ++IVS+TITE GY + +G D+ N ++ DL NP+ P + G + EALR R D G Sbjct: 120 PQVKIVSLTITEKGYCSDPQSGQLDINNGLIQHDLNNPQTPQSALGLITEALRVRRDKGL 179 Query: 181 KAFTVMSCDNLRHNGNVARKAFLGYAKARDPELAKWIEENATFPNGMVDRITPTVSAEIA 240 F+V+SCDN+ NG + ++A L +AK D LA WIE+N TFP+ MVDRI P ++ + Sbjct: 180 APFSVLSCDNIPENGLLTKEAVLSFAKQLDSALAAWIEQNVTFPSTMVDRIVPAMTDDAF 239 Query: 241 KKLNAASGLDDDLPLVAEDFHQWVLEDQFADGRPPLEKAGVQMVGDVTDWEYVKIRMLNA 300 ++ G D +V ED+ QWV+ED F GRP +KAG V DV +E +K+RMLN Sbjct: 240 AVIDECIGYRDPCGIVCEDYRQWVIEDNFVAGRPDWDKAGAMFVADVLPYEEMKLRMLNG 299 Query: 301 GHVMLCFPGILVGYENVDDAIEDSELLGNLKNYLNKDVIPTLKAPSGMTLEGYRDSVISR 360 H L + G L GY+ + +EDS+ + ++ +L + LE Y +I R Sbjct: 300 SHSFLAYNGFLAGYDFIYQCMEDSDFRATTLRLMLEEQAKSLNPSLKVDLEQYASLLIGR 359 Query: 361 FSNKAMSDQTLRIASDGCSKV 381 FSN + +T +IA DG K+ Sbjct: 360 FSNPNIKHKTAQIAMDGTQKL 380 Lambda K H 0.317 0.135 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 532 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 485 Length of database: 492 Length adjustment: 34 Effective length of query: 451 Effective length of database: 458 Effective search space: 206558 Effective search space used: 206558 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory