Align L-threonine 3-dehydrogenase (EC 1.1.1.103) (characterized)
to candidate WP_087507677.1 CBE68_RS18265 L-threonine 3-dehydrogenase
Query= BRENDA::P07913 (341 letters) >NCBI__GCF_002165625.1:WP_087507677.1 Length = 344 Score = 588 bits (1516), Expect = e-173 Identities = 275/340 (80%), Positives = 312/340 (91%) Query: 1 MKALSKLKAEEGIWMTDVPVPELGHNDLLIKIRKTAICGTDVHIYNWDEWSQKTIPVPMV 60 MKAL+KLKAE GIWMT+VPVPELGHNDLLIKI KTAICGTD+HIY WD+WSQ+TIPVPMV Sbjct: 1 MKALAKLKAEPGIWMTEVPVPELGHNDLLIKIHKTAICGTDLHIYKWDQWSQQTIPVPMV 60 Query: 61 VGHEYVGEVVGIGQEVKGFKIGDRVSGEGHITCGHCRNCRGGRTHLCRNTIGVGVNRPGC 120 VGHEY GEVV IGQEV+GF+IGDRVSGEGHITCGHCRNCR GR HLCRNT GVGVNRPGC Sbjct: 61 VGHEYAGEVVAIGQEVRGFEIGDRVSGEGHITCGHCRNCRAGRRHLCRNTTGVGVNRPGC 120 Query: 121 FAEYLVIPAFNAFKIPDNISDDLAAIFDPFGNAVHTALSFDLVGEDVLVSGAGPIGIMAA 180 FAEYLVIPA+NAFK+ D+ISDDLAAIFDPFGNAVHTALSFDLVGEDVL++GAGPIGIMAA Sbjct: 121 FAEYLVIPAYNAFKLADDISDDLAAIFDPFGNAVHTALSFDLVGEDVLITGAGPIGIMAA 180 Query: 181 AVAKHVGARNVVITDVNEYRLELARKMGITRAVNVAKENLNDVMAELGMTEGFDVGLEMS 240 AVA+H GAR+VVITDVN YRL+LAR+MG +RAV+V++++L++VM ELGMTEGFDVG+EMS Sbjct: 181 AVARHSGARHVVITDVNRYRLDLARQMGASRAVDVSQQSLDEVMTELGMTEGFDVGMEMS 240 Query: 241 GAPPAFRTMLDTMNHGGRIAMLGIPPSDMSIDWTKVIFKGLFIKGIYGREMFETWYKMAA 300 G P AF +L MNHGG++A+LGIPPS M IDW +VIFKGL IKGIYGREMFETWYKMA+ Sbjct: 241 GVPAAFCDLLAKMNHGGKVALLGIPPSSMPIDWNQVIFKGLTIKGIYGREMFETWYKMAS 300 Query: 301 LIQSGLDLSPIITHRFSIDDFQKGFDAMRSGQSGKVILSW 340 L+QSGLDLSP++TH + +DDFQ+GFDAM SGQ GKVIL W Sbjct: 301 LVQSGLDLSPMLTHHYKVDDFQQGFDAMLSGQCGKVILDW 340 Lambda K H 0.322 0.140 0.433 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 550 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 341 Length of database: 344 Length adjustment: 29 Effective length of query: 312 Effective length of database: 315 Effective search space: 98280 Effective search space used: 98280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
Align candidate WP_087507677.1 CBE68_RS18265 (L-threonine 3-dehydrogenase)
to HMM TIGR00692 (tdh: L-threonine 3-dehydrogenase (EC 1.1.1.103))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00692.hmm # target sequence database: /tmp/gapView.2453844.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00692 [M=340] Accession: TIGR00692 Description: tdh: L-threonine 3-dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.2e-175 567.6 0.1 4.8e-175 567.4 0.1 1.0 1 NCBI__GCF_002165625.1:WP_087507677.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_002165625.1:WP_087507677.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 567.4 0.1 4.8e-175 4.8e-175 1 340 [] 3 340 .. 3 340 .. 0.99 Alignments for each domain: == domain 1 score: 567.4 bits; conditional E-value: 4.8e-175 TIGR00692 1 almkkkaeeGavltevpvpelgknevlikvkatsicGtdvhiynwdewaqkrikvpqvlGhevaGevvgiGee 73 al+k+kae G+++tevpvpelg+n++lik+++t+icGtd+hiy+wd+w+q++i+vp+v+Ghe+aGevv iG+e NCBI__GCF_002165625.1:WP_087507677.1 3 ALAKLKAEPGIWMTEVPVPELGHNDLLIKIHKTAICGTDLHIYKWDQWSQQTIPVPMVVGHEYAGEVVAIGQE 75 799********************************************************************** PP TIGR00692 74 vegvkvGdyvsaethivcGkcvacrrGkshvcrntkivGvdtaGvfaeyvvvpadnifknpkdidpelaaiqe 146 v+g+++Gd+vs+e+hi+cG+c++cr+G+ h+crnt++vGv+++G+faey+v+pa n+fk +di+++laai++ NCBI__GCF_002165625.1:WP_087507677.1 76 VRGFEIGDRVSGEGHITCGHCRNCRAGRRHLCRNTTGVGVNRPGCFAEYLVIPAYNAFKLADDISDDLAAIFD 148 ************************************************************************* PP TIGR00692 147 plGnavdtvlesdlaGesvlvsGaGpiGllavavakaaGasqvivsdkneyrlelakkvGatrvvnvakedlv 219 p+Gnav+t+l++dl+Ge+vl++GaGpiG++a+ava+++Ga++v+++d+n yrl+la+++Ga+r+v+v ++ l NCBI__GCF_002165625.1:WP_087507677.1 149 PFGNAVHTALSFDLVGEDVLITGAGPIGIMAAAVARHSGARHVVITDVNRYRLDLARQMGASRAVDVSQQSLD 221 ************************************************************************* PP TIGR00692 220 kvvaeltsgeGvdvvlelsGapkaleqgldavangGrvallglpeskvtidltnkvifkgltikGitGrklfe 292 +v++el+++eG+dv++e+sG p a+ + l+ +++gG+vallg+p+s++ id++ +vifkgltikGi+Gr++fe NCBI__GCF_002165625.1:WP_087507677.1 222 EVMTELGMTEGFDVGMEMSGVPAAFCDLLAKMNHGGKVALLGIPPSSMPIDWN-QVIFKGLTIKGIYGREMFE 293 ****************************************************9.9****************** PP TIGR00692 293 twykvsrliqsnkldlapiithkfkldefekgfelmrsGksGkvilil 340 twyk++ l+qs +ldl+p++th++k+d+f++gf++m sG++Gkvil + NCBI__GCF_002165625.1:WP_087507677.1 294 TWYKMASLVQS-GLDLSPMLTHHYKVDDFQQGFDAMLSGQCGKVILDW 340 ***********.9********************************965 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (340 nodes) Target sequences: 1 (344 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 9.85 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory