Align D-xylulose reductase (EC 1.1.1.9) (characterized)
to candidate WP_087504701.1 CBE68_RS03625 SDR family oxidoreductase
Query= BRENDA::Q8GR61 (262 letters) >NCBI__GCF_002165625.1:WP_087504701.1 Length = 266 Score = 106 bits (264), Expect = 6e-28 Identities = 82/258 (31%), Positives = 125/258 (48%), Gaps = 18/258 (6%) Query: 7 GKVCLVTGAGGNIGLATALRLAEEGTAIALLDMNREALEKAEASVREKGVEARSYVCDVT 66 GK +VTG IG A L G I + D+ +++ A +R +G + D+ Sbjct: 6 GKRAIVTGGAQGIGRACVESLLAHGCQITISDIEQQSGLDAVDELRGQGGDVHFLHGDMG 65 Query: 67 SEEAVIGTVDSVVRDFGKIDFLFNNAGYQGAF-APVQDYPSDDFARVLTINVTGAFHVLK 125 ++ V+ G +DFL NNA AF A + + + R LT+ + + Sbjct: 66 DDKFCRQLVEYACNKMGGVDFLVNNAF---AFTAGGLEATREQWLRSLTVGPMAFAAMTQ 122 Query: 126 AVSRQMITQNYGRIVNTASMAGVKGPPNMAAYGTSKGAIIALTETAALDLAPYNIRVNAI 185 V+ M G IVN +S++ P Y ++KGA+ LT+ +ALDLAP NIRVN+I Sbjct: 123 FVAPYMTKAGGGAIVNISSISAHIAQPGRWTYNSAKGAVGQLTKCSALDLAPKNIRVNSI 182 Query: 186 SPGYMGPGFMWERQVELQAKVGSQYFSTDPKVVAQQMIGSVPM-RRYGDINEIPGVVAFL 244 SPG+ +W R+V+ A + + + GS M RR G E+ V FL Sbjct: 183 SPGW-----IWTREVDKAAGYNREKYG--------PIWGSYHMLRRCGYPEEVASAVMFL 229 Query: 245 LGDDSSFMTGVNLPIAGG 262 L ++SF+TG +LP+ GG Sbjct: 230 LSQEASFITGTDLPVDGG 247 Lambda K H 0.318 0.135 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 202 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 266 Length adjustment: 25 Effective length of query: 237 Effective length of database: 241 Effective search space: 57117 Effective search space used: 57117 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory