Align Glyoxal reductase; GR; Methylglyoxal reductase; EC 1.1.1.-; EC 1.1.1.283 (characterized)
to candidate WP_079557850.1 CDL62_RS17695 aldo/keto reductase
Query= SwissProt::O32210 (276 letters) >NCBI__GCF_002201795.1:WP_079557850.1 Length = 277 Score = 347 bits (891), Expect = e-100 Identities = 164/274 (59%), Positives = 213/274 (77%) Query: 3 TSLKDTVKLHNGVEMPWFGLGVFKVENGNEATESVKAAIKNGYRSIDTAAIYKNEEGVGI 62 T +K TV L NGVEMP+FGLGVFK G+E SV A++ GYR IDTA IY+NEEGVG Sbjct: 4 TDIKGTVTLANGVEMPYFGLGVFKSRGGSEVINSVTWALEAGYRHIDTATIYENEEGVGE 63 Query: 63 GIKESGVAREELFITSKVWNEDQGYETTLAAFEKSLERLQLDYLDLYLIHWPGKDKYKDT 122 I ++ + R+E+FITSKVWN DQG++ TL AF++SL+RL DYLDLYL+HWP K KYK+T Sbjct: 64 AISKAHLNRDEVFITSKVWNSDQGFDNTLRAFDESLKRLSTDYLDLYLVHWPVKGKYKET 123 Query: 123 WRALEKLYKDGKIRAIGVSNFQVHHLEELLKDAEIKPMVNQVEFHPRLTQKELRDYCKGQ 182 W+ALEKLYKDG++RAIGVSNF HHL++L++D ++KPMVNQ EFHPRL Q +L C Sbjct: 124 WKALEKLYKDGRVRAIGVSNFLAHHLDDLIQDCDVKPMVNQFEFHPRLVQPDLVKKCLEL 183 Query: 183 GIQLEAWSPLMQGQLLDNEVLTQIAEKHNKSVAQVILRWDLQHGVVTIPKSIKEHRIIEN 242 I+ EAWSPLMQG + D + L ++A K++K+VAQV+LRW+LQ G++TIPKS ++RI N Sbjct: 184 NIRPEAWSPLMQGGVFDIKELQKMANKYSKNVAQVVLRWNLQKGIITIPKSANKNRIESN 243 Query: 243 ADIFDFELSQEDMDKIDALNKDERVGPNPDELLF 276 A IFDFE+S++DM ID L+K+ R+G +PD F Sbjct: 244 AHIFDFEISEDDMKAIDKLDKNRRIGADPDNFDF 277 Lambda K H 0.316 0.135 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 271 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 277 Length adjustment: 25 Effective length of query: 251 Effective length of database: 252 Effective search space: 63252 Effective search space used: 63252 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory