Align Putative 2-dehydro-3-deoxy-D-gluconate aldolase YagE; KDG aldolase YagE; Putative 2-dehydro-3-deoxy-D-pentonate aldolase YagE; EC 4.1.2.51; EC 4.1.2.28 (characterized)
to candidate WP_079557617.1 CDL62_RS03500 4-hydroxy-tetrahydrodipicolinate synthase
Query= SwissProt::P75682 (302 letters) >NCBI__GCF_002201795.1:WP_079557617.1 Length = 296 Score = 135 bits (339), Expect = 1e-36 Identities = 92/291 (31%), Positives = 146/291 (50%), Gaps = 9/291 (3%) Query: 9 GIIPPVSTIFTADGQLDKPGTAALIDDLIKAGVDGLFFLGSGGEFSQLGAEERKAIARFA 68 G I + T F +G +D +LI+ I+ G DGL G+ GE L +E + Sbjct: 8 GSIVAIVTPFKENGDIDFETYDSLIEWHIEQGTDGLVVCGTTGETPALSEDEDAMMIERT 67 Query: 69 IDHVDRRVPVLIGTGGTNARETIELSQHAQQAGADGIVVINPYYWKVSEANLIRYFEQVA 128 + V+ R+PV+ GTG + ++ I+ S A++AG D ++V+ PYY K S+ + ++F VA Sbjct: 68 VKKVNGRIPVIAGTGSNSTKDCIKYSTTAKKAGVDALLVVAPYYNKPSDKGMYQHFSGVA 127 Query: 129 DSVTLPVMLYNFPALTGQDLTPALVKTLADSRSNIIGIKDTIDSVAHLRSMIHTVKGAHP 188 +V LP++LYN P TG ++ L LA+ NI+ +K+ S++ ++ Sbjct: 128 KAVDLPIILYNVPGRTGSCISAKLAIRLANDHKNIVAVKEAGGSMSVFAELL---ANRPE 184 Query: 189 HFTVLCGYDDHLFNTLLLGGDGAISASGNFAPQVSVNLLKAWRDGDVAKAAG-YHQTLLQ 247 F V G D + LLG DG IS N P+ L+ + DGDV K+ + + Sbjct: 185 GFKVYSGDDFLATSANLLGADGCISVIANLIPKDFHELMVSSLDGDVRKSKSLFFKYKAL 244 Query: 248 IPQMYQLDTPFVNVIKEAIVLCGRPVSTHVLPPASPLDEPRKA---QLKTL 295 + M+ P +K A+ L G+ T LP + D+ RKA +LKTL Sbjct: 245 MEHMFAESNPL--PVKTALALMGKVNETFRLPLCTMEDDTRKALENELKTL 293 Lambda K H 0.320 0.138 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 195 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 302 Length of database: 296 Length adjustment: 27 Effective length of query: 275 Effective length of database: 269 Effective search space: 73975 Effective search space used: 73975 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory