Align AraV, component of Arabinose, fructose, xylose porter (characterized)
to candidate WP_079558318.1 CDL62_RS04425 ABC transporter ATP-binding protein
Query= TCDB::Q97UF2 (371 letters) >NCBI__GCF_002201795.1:WP_079558318.1 Length = 358 Score = 194 bits (492), Expect = 4e-54 Identities = 107/290 (36%), Positives = 173/290 (59%), Gaps = 7/290 (2%) Query: 4 IRVENLSKIFKKGKTEVKAVDNVSITIDSGMAFGVLGPSGHGKTTFLRLIAGLEEPTSGY 63 + +NL+K + K +++ N +++++ G +LG SG GKTT LR+IAG E G Sbjct: 5 LSAKNLTKTYPGNK--YRSLINFNLSVEKGQITALLGESGCGKTTALRIIAGFESSEKGE 62 Query: 64 IYFDNEAVSSPRRVMMSPEKRGIAMVFQNWALYPNMTVFDNIAFPLKLAKVPKDKIENKV 123 + +N +++ R+ P RG+ +VFQ++AL+P+ TV+ NI F L K+PK++ ++ Sbjct: 63 VIINNRVMAN-ERLFTEPNNRGVGIVFQDYALFPHKTVWKNIVFGLN--KLPKNEQQSVA 119 Query: 124 KEVSEELGLSGVLNRYPKELSGGQMQRTAIARALVKDPKVLLLDEPFSNLDAQIRESARA 183 + V GL G NRYP +LSGGQ QR A+ARAL +P VLL+DEPFSN+D+ + R Sbjct: 120 ERVLSLTGLKGYENRYPHQLSGGQKQRVALARALAPNPGVLLMDEPFSNIDSMKKNQIRE 179 Query: 184 LVRKIQRERKLTTLIVSHDPADIFAIANKAGVIVNGKFAQIGTPTEIYEYPATDLIARLT 243 +R+I + T + V+HD D+ AIA++ V+ G Q GTP EI+ +PA + IA Sbjct: 180 EIREILKAAGTTVVFVTHDTKDVLAIADRVAVMKEGVLMQEGTPKEIFNHPANEYIAHFF 239 Query: 244 GEINLIQAKIIENNAIIANLKV-PLNNMELKGQSNIVIGLRPDDLTLSDT 292 G+ N+ + ++E + + + V L+ + G+S I I +RP+ + T Sbjct: 240 GKTNIFKGDVVEKGKVESEIGVFNLSKSKDLGKS-ISISVRPNSFLVHTT 288 Lambda K H 0.317 0.136 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 284 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 371 Length of database: 358 Length adjustment: 29 Effective length of query: 342 Effective length of database: 329 Effective search space: 112518 Effective search space used: 112518 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory