Align D-xylulose reductase (EC 1.1.1.9) (characterized)
to candidate WP_079555883.1 CDL62_RS06765 SDR family oxidoreductase
Query= BRENDA::Q8GR61 (262 letters) >NCBI__GCF_002201795.1:WP_079555883.1 Length = 271 Score = 122 bits (306), Expect = 8e-33 Identities = 80/266 (30%), Positives = 131/266 (49%), Gaps = 19/266 (7%) Query: 6 NGKVCLVTGAGGNIGLATALRLAEEGTAIALLDMNREALEKAEASVREKGVEARSYVCDV 65 +GK+ +VTG GG +G + + L + G + +LD+ +EAL+ ++ G E C+V Sbjct: 9 SGKIAIVTGGGGVLGSSISENLLKNGAKVIILDIRQEALDARLEKLQTLG-EVTGLTCNV 67 Query: 66 TSEEAVIGTVDSVVRDFGKIDFLFNNAGYQ---GAFAPVQ---DYPSDDFARVLTINVTG 119 E++ + +G+ID L N AG G Q D +DF +V +N+TG Sbjct: 68 LDMESLRNVRQQIKEQYGRIDILVNAAGGNTPGGTLTEEQTIFDLKMEDFHKVTDLNLTG 127 Query: 120 AFHVLKAVSRQMITQNYGRIVNTASMAGVKGPPNMAAYGTSKGAIIALTETAALDLAPY- 178 + M Q G IVN +SMA + Y +K + T+ A+++A Sbjct: 128 TIYPSIVFGEVMAEQGEGSIVNISSMATYSAITRVPGYSVAKTGVNIFTQWLAMEMATKF 187 Query: 179 --NIRVNAISPGYMGPGFMWERQVELQAKVGSQYFSTDPKVVAQQMIGSVPMRRYGDINE 236 IRVNAI+PG+ F+ ++ + KV+A+ PM+R+GDI+E Sbjct: 188 NEKIRVNAIAPGF----FIGDQNRAVLINPDGSLTERSKKVIAR-----TPMKRFGDISE 238 Query: 237 IPGVVAFLLGDDSSFMTGVNLPIAGG 262 + G+V FL + +SF+TG +P+ GG Sbjct: 239 LNGIVQFLCSNAASFITGTIIPVDGG 264 Lambda K H 0.318 0.135 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 216 Number of extensions: 12 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 271 Length adjustment: 25 Effective length of query: 237 Effective length of database: 246 Effective search space: 58302 Effective search space used: 58302 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory