Align D-lactate oxidase, FAD-linked subunit (EC 1.1.3.15) (characterized)
to candidate WP_088754936.1 CEJ45_RS09745 FAD-binding oxidoreductase
Query= reanno::Smeli:SMc00832 (479 letters) >NCBI__GCF_002213425.1:WP_088754936.1 Length = 468 Score = 185 bits (469), Expect = 3e-51 Identities = 140/464 (30%), Positives = 222/464 (47%), Gaps = 32/464 (6%) Query: 25 LADLLPEGGLISDERGLKPFETDAFIAYRRMPLAVVLPETTEHVAAVLKYCSRYGIPIVP 84 L D G ++D+RG Y LAV+ P VA +++ C+R+ IP+VP Sbjct: 18 LTDAADTAGYLTDQRG----------RYTGRALAVLRPADAAEVATLVQLCARHAIPLVP 67 Query: 85 RGAGTSLSGGAIP--QEDAIVVGLSKMSRTLDIDLFNRTATVQAGVTNLNISDAVSADGF 142 +G T L G++P Q +A+V+ L +++R +D N T TV+AG ++ + +A Sbjct: 68 QGGNTGLVLGSVPDQQGNAVVLSLRRLNRIRAVDPVNNTMTVEAGCVLQHLQEQAAAVER 127 Query: 143 FYAPDPSSQLACTIGGNIGMNSGGAHCLKYGVTTNNLLGVKMVLFDGTVI-ELGGKALDA 201 + +++ +CTIGGN+ N+GG L+YG T LG+++V +G +I L G D Sbjct: 128 LFPLSLAAEGSCTIGGNLSTNAGGTGVLRYGNTRELCLGLEVVTAEGEIISSLKGLRKDN 187 Query: 202 PGYDLLGLVCGSEGQLGIVTEATVRLIAKPEGARPVLFGFASSESAGSCVADI-IGSGII 260 GYDL L G+EG LGI+T A V+L +P L + A + G Sbjct: 188 TGYDLRDLFIGAEGTLGIITAAVVKLFPQPRAQLTALVALQTPAQALQLLQQAQARCGSA 247 Query: 261 PVAIEFMDRPAIE-ICEAFAQAGYPLDVEALLIVEVEGSEAEMDATLAGIIEIARRHGVM 319 E M ++ +C+ F P V +E S+ E + I E + Sbjct: 248 LTGFELMSDFCLQLVCKHFPDQRLPFAHAHPQYVLLELSDNESEDHARTIFETLIGQALE 307 Query: 320 TIRESQSALEAAL-----IWKGRKSAFGATGRIADYICMDGTVPLSQLSHVLRRTGEIV- 373 + + A+L +W+ R+S A I D +VP+S+++ + T +V Sbjct: 308 QGLAQDAVIAASLAQSRALWRLRESISMAQAHEGKNIKHDISVPISRIAEFMEVTDSLVQ 367 Query: 374 -AGYGLRVANVFHAGDGNMHPLILYNINDPEEAARAE--AAGNDILKLCVEA----GGCL 426 A G R+ + H GDGN+H YN++ P A A+ A DI ++ ++ GG + Sbjct: 368 QAAPGCRMVSFGHLGDGNLH----YNVSPPVGVADADFLARQGDINRVVHDSVDRFGGSI 423 Query: 427 TGEHGVGIEKRDLMLHQYSRADLGQQMAARAAFDPQWLMNPSKV 470 + EHG+G KR+ +L S +L A + A DPQ LMNP KV Sbjct: 424 SAEHGLGALKREEILRYKSPVELRLMRAIKQALDPQQLMNPGKV 467 Lambda K H 0.320 0.138 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 520 Number of extensions: 24 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 479 Length of database: 468 Length adjustment: 33 Effective length of query: 446 Effective length of database: 435 Effective search space: 194010 Effective search space used: 194010 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory