Align D-2-hydroxyglutarate--pyruvate transhydrogenase DLD2; D-2HG--pyruvate transhydrogenase DLD2; Actin-interacting protein 2; D-lactate dehydrogenase [cytochrome] 2, mitochondrial; D-lactate ferricytochrome C oxidoreductase; D-LCR; EC 1.1.99.40; EC 1.1.2.4 (characterized)
to candidate WP_088755932.1 CEJ45_RS15240 FAD-binding oxidoreductase
Query= SwissProt::P46681 (530 letters) >NCBI__GCF_002213425.1:WP_088755932.1 Length = 471 Score = 309 bits (791), Expect = 2e-88 Identities = 169/468 (36%), Positives = 271/468 (57%), Gaps = 16/468 (3%) Query: 70 KSILSEQEILRASESEDLSFYNEDWMRKYKGQSKLVLRPKSVEKVSLILNYCNDEKIAVV 129 +SI+ + ++ A+E + + Y +DW+ K+ G+ +V+RP + + ++ C+ +V Sbjct: 13 RSIVGDAGLVTAAEEQ--ASYVKDWLNKWHGRVAVVVRPADTAQTAEVVRLCHRTHTPIV 70 Query: 130 PQGGNTGLVGGSVPIFD--ELILSLANLNKIRDFDPVSGILKCDAGVILENANNYVMEQN 187 QGGNTG+ GG+ P ++ILS +N+IR DP++ + DAGVIL +A + Sbjct: 71 TQGGNTGMSGGATPDDSGAQVILSTTRMNRIRAVDPINNTMTVDAGVILAHAQDAARAAG 130 Query: 188 YMFPLDLGAKGSCHVGGVVATNAGGLRLLRYGSLHGSVLGLEVVMPNGQIVNSMHSMRKD 247 FPL LGA+GSC +GG +ATNAGG+ +LR+G++ LGLEVV+P+G+I N + +RKD Sbjct: 131 RYFPLSLGAEGSCTIGGNLATNAGGIAVLRFGNMRELALGLEVVLPDGRIWNGLRGLRKD 190 Query: 248 NTGYDLKQLFIGSEGTIGIITGVSILTVPKPKAFNVSYLSVESFEDVQKVFVRARQELSE 307 NTGYDL+ LFIGSEG++G+ITG + +P A +++ +S + ++ R R + Sbjct: 191 NTGYDLRDLFIGSEGSLGVITGAVLKLFSQPHARATAWVGCDSLAQLAELLARTRARCGD 250 Query: 308 ILSAFEFMDAKSQVLAKSQLKDAAFPLEDEHPFYILIETSGSNKDHDDSKLETFLENVME 367 L AFE M A S L + D PL + LIE + + + LE L ME Sbjct: 251 RLVAFEMMSAASLALVLQHVTDTRAPLAQPARYNALIELADTEDLGLQAMLEELLGQAME 310 Query: 368 EGIVTDGVVAQDETELQNLWKWREMIPEASQANGGVYKYDVSLPLKDLYSLVEATNARLS 427 + +V D ++ + T+ LWK RE I +A G + K+D++LP+ + VE ++ Sbjct: 311 DVLVNDAMLCTNGTQAAALWKIREGISQAQVRAGKLIKHDIALPISAIAEFVEQAERMIA 370 Query: 428 EAELVGDSPKPVVGAIGYGHVGDGNLHLNVAV---REYNKNIEKTLE--PFVYEFVSSKH 482 EL + I +GH+GDGNLH NV + Y + + TL+ V++ V+ K Sbjct: 371 ACELQAE-------IINFGHLGDGNLHFNVMIPLSSSYEEVQQATLQLNRLVHDLVTEKQ 423 Query: 483 GSVSAEHGLGFQKKNYIGYSKSPEEVKMMKDLKVHYDPNGILNPYKYI 530 GS+SAEHG+G +++ + + KSP E+++M +K +DPN I+NP K + Sbjct: 424 GSISAEHGVGQLRRDELRHYKSPLEMELMLRIKQAFDPNLIMNPGKLL 471 Lambda K H 0.316 0.135 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 526 Number of extensions: 21 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 530 Length of database: 471 Length adjustment: 34 Effective length of query: 496 Effective length of database: 437 Effective search space: 216752 Effective search space used: 216752 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory