Align ABC transporter membrane-spanning permease-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate WP_034335500.1 CEJ45_RS01015 branched-chain amino acid ABC transporter permease
Query= TCDB::Q8DQH9 (318 letters) >NCBI__GCF_002213425.1:WP_034335500.1 Length = 291 Score = 180 bits (457), Expect = 3e-50 Identities = 100/283 (35%), Positives = 164/283 (57%), Gaps = 7/283 (2%) Query: 35 YVQILQQIGINIILAVGLNLIVGFSGQFSLGHAGFMAIGAYAAAIIGSKSPTYGAFFGAM 94 Y ++ IG+N +LA+ + + + G SL +A FM IGAY A+++ + F A+ Sbjct: 14 YNTVIFSIGVNAMLALSIYVTLS-CGLLSLANAAFMGIGAYTASLLTMQFDM--PFPIAL 70 Query: 95 LVGALLSGAVALLVGIPTLRLKGDYLAVATLGVSEIIRIFIINGGSLTNGAAGILGIPNF 154 G +L VAL++GIPTLRL G YLA+ATLG E++R+ ++N +T G G+ G+P Sbjct: 71 AAGGVLPSLVALVIGIPTLRLSGVYLAMATLGFGEVVRVIVLNL-EITGGPMGLNGVPPI 129 Query: 155 TTWQMVYFFVVITTIATLNFLRSPIGRSTLSVREDEIAAESVGVNTTKIKIIAFVFGAIT 214 T W + + +T A RS GR+ +++EDE+AA +GVN K++AFV GA Sbjct: 130 TEWWHIVLLLGVTIYALARLRRSKTGRAFEAIKEDEVAARLMGVNVAGYKLLAFVIGAAI 189 Query: 215 ASIAGSLQAGFIGSVVPKDYTFINSINVLIIVVFGGLGSITGAIVSAIVLGILNMLLQDV 274 A +AG L A F ++ P +Y F N++++L + VFGG ++ G ++ + +L +L +L+ Sbjct: 190 AGVAGGLNAHFTFTIGPNNYGFENAVDILTMAVFGGTSNLIGPMIGSTILSLLPEVLRHF 249 Query: 275 ASVRMIIYALALVLVMIFRPGGLLGTWELSLSRFFKKSKKEEQ 317 R+ I L L+LV+++ P G+ W+ R F E++ Sbjct: 250 KDFRLAINGLILILVVLYLPKGI---WDPRRIRAFLGRNAEKK 289 Lambda K H 0.327 0.143 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 201 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 291 Length adjustment: 27 Effective length of query: 291 Effective length of database: 264 Effective search space: 76824 Effective search space used: 76824 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory