Align Propionyl-CoA carboxylase, biotin carboxylase and biotin-carboxyl carrier subunit; PCC; EC 6.4.1.3; EC 6.3.4.14 (characterized)
to candidate WP_088756870.1 CEJ45_RS20130 acetyl-CoA carboxylase biotin carboxylase subunit
Query= SwissProt::I3R7G3 (601 letters) >NCBI__GCF_002213425.1:WP_088756870.1 Length = 462 Score = 395 bits (1014), Expect = e-114 Identities = 207/440 (47%), Positives = 285/440 (64%), Gaps = 3/440 (0%) Query: 4 KVLVANRGEIAVRVMRACEELGVRTVAVYSEADKHGGHVRYADEAYNIGPARAADSYLDH 63 K+L+ANRGEIAVR++RA + LG++TVA SEAD R ADE IGPARA SYL+ Sbjct: 7 KLLIANRGEIAVRIIRAAQALGIKTVAACSEADADSLAARMADEVQLIGPARADRSYLNV 66 Query: 64 ESVIEAARKADADAIHPGYGFLAENAEFARKVEDSEFTWVGPSADAMERLGEKTKARSLM 123 +++++AAR + ADAIHPGYGFL+ENA FA V + +VGP AD + R+G+K +AR Sbjct: 67 DALLKAARDSGADAIHPGYGFLSENATFAEAVSAAGLIFVGPEADTIRRMGDKAEARRTA 126 Query: 124 QDADVPVVPGTTEPADSAEDVKAVADDYGYPVAIKAEGGGGGRGLKVVHSEDEVDGQFET 183 A VPVVPG+ + + A AD+ GYP+ IKA GGGGRG+++ E+ +F Sbjct: 127 AAAGVPVVPGSADELEDVATALACADEIGYPLLIKASAGGGGRGIRMARDAAELAREFPL 186 Query: 184 AKREGEAYFDNASVYVEKYLEAPRHIEVQILADEHGNVRHLGERDCSLQRRHQKVIEEAP 243 A+ E +A F + +VY+E+++ RHIEVQIL D V HL ER+CSLQRR QKV EEAP Sbjct: 187 AQGEAQAAFGSGAVYLERFIRRARHIEVQILGDGQRAV-HLFERECSLQRRRQKVFEEAP 245 Query: 244 SPALSEDLRERIGEAARRGVRAAEYTNAGTVEFLVED--GEFYFMEVNTRIQVEHTVTEE 301 SP L+ R+ + E+A R Y AGT+E+L +D GEF+F+E+NTRIQVEH VTE Sbjct: 246 SPVLTPSQRQALCESAVRLAEQLRYRGAGTLEYLFDDESGEFFFIEMNTRIQVEHPVTEM 305 Query: 302 VTGLDVVKWQLRVAAGEELDFSQDDVEIEGHSMEFRINAEAPEKEFAPATGTLSTYDPPG 361 +TG+D+V+ LR+A GE L Q D+ ++G ++E RINAE PE+ F P GT++ P Sbjct: 306 ITGIDLVQAMLRIAGGEPLGLQQSDIRMQGAALEMRINAEDPERNFFPCPGTVAELQWPQ 365 Query: 362 GIGIRMDDAVRQGDEIGGDYDSMIAKLIVTGSDREEVLVRAERALNEFDIEGLRTVIPFH 421 G G+R++ + G I YDS++AKL+V G DR + + RA AL I G+ T +P H Sbjct: 366 GDGVRVESHLYAGYRIPPYYDSLLAKLVVHGKDRAQAIARARAALTATRITGMATTLPLH 425 Query: 422 RLMLTDEAFREGSHTTKYLD 441 + +L D + T L+ Sbjct: 426 QWLLADARVQAARFDTGALE 445 Lambda K H 0.312 0.132 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 628 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 601 Length of database: 462 Length adjustment: 35 Effective length of query: 566 Effective length of database: 427 Effective search space: 241682 Effective search space used: 241682 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory