Protein WP_054656487.1 in Lactobacillus silagei IWT126
Annotation: NCBI__GCF_002217945.1:WP_054656487.1
Length: 455 amino acids
Source: GCF_002217945.1 in NCBI
Candidate for 27 steps in catabolism of small carbon sources
| Pathway | Step | Score | Similar to | Id. | Cov. | Bits | Other hit | Other id. | Other bits |
|---|
| L-arabinose catabolism | araE | hi | Arabinose/xylose transporter, AraE (characterized) | 73% | 94% | 661 | D-xylose transporter; D-xylose-proton symporter | 42% | 338.6 |
| D-xylose catabolism | xylT | hi | Arabinose/xylose transporter, AraE (characterized) | 73% | 94% | 661 | Probable metabolite transport protein CsbC | 40% | 323.6 |
| D-cellobiose catabolism | MFS-glucose | lo | The D-glucose:H+ symporter, GlcP (glucose uptake is inhibited by 2-deoxyglucose, mannose and galactose) (characterized) | 38% | 87% | 305.1 | Arabinose/xylose transporter, AraE | 73% | 661.0 |
| D-glucose catabolism | MFS-glucose | lo | The D-glucose:H+ symporter, GlcP (glucose uptake is inhibited by 2-deoxyglucose, mannose and galactose) (characterized) | 38% | 87% | 305.1 | Arabinose/xylose transporter, AraE | 73% | 661.0 |
| lactose catabolism | MFS-glucose | lo | The D-glucose:H+ symporter, GlcP (glucose uptake is inhibited by 2-deoxyglucose, mannose and galactose) (characterized) | 38% | 87% | 305.1 | Arabinose/xylose transporter, AraE | 73% | 661.0 |
| D-maltose catabolism | MFS-glucose | lo | The D-glucose:H+ symporter, GlcP (glucose uptake is inhibited by 2-deoxyglucose, mannose and galactose) (characterized) | 38% | 87% | 305.1 | Arabinose/xylose transporter, AraE | 73% | 661.0 |
| sucrose catabolism | MFS-glucose | lo | The D-glucose:H+ symporter, GlcP (glucose uptake is inhibited by 2-deoxyglucose, mannose and galactose) (characterized) | 38% | 87% | 305.1 | Arabinose/xylose transporter, AraE | 73% | 661.0 |
| trehalose catabolism | MFS-glucose | lo | The D-glucose:H+ symporter, GlcP (glucose uptake is inhibited by 2-deoxyglucose, mannose and galactose) (characterized) | 38% | 87% | 305.1 | Arabinose/xylose transporter, AraE | 73% | 661.0 |
| myo-inositol catabolism | iolT | lo | Myo-Inositol uptake porter, IolT1 (Km=0.2mM) (characterized) | 37% | 92% | 289.7 | Arabinose/xylose transporter, AraE | 73% | 661.0 |
| D-fructose catabolism | glcP | lo | D-fructose transporter, sugar porter family (characterized) | 34% | 94% | 250.8 | Arabinose/xylose transporter, AraE | 73% | 661.0 |
| sucrose catabolism | glcP | lo | D-fructose transporter, sugar porter family (characterized) | 34% | 94% | 250.8 | Arabinose/xylose transporter, AraE | 73% | 661.0 |
| xylitol catabolism | PLT5 | lo | Polyol (xylitol):H+ symporter, PLT4 (characterized) | 33% | 88% | 235.7 | Arabinose/xylose transporter, AraE | 73% | 661.0 |
| glycerol catabolism | PLT5 | lo | polyol transporter 5 (characterized) | 32% | 84% | 233.8 | Arabinose/xylose transporter, AraE | 73% | 661.0 |
| D-mannitol catabolism | PLT5 | lo | polyol transporter 5 (characterized) | 32% | 84% | 233.8 | Arabinose/xylose transporter, AraE | 73% | 661.0 |
| D-ribose catabolism | PLT5 | lo | polyol transporter 5 (characterized) | 32% | 84% | 233.8 | Arabinose/xylose transporter, AraE | 73% | 661.0 |
| D-sorbitol (glucitol) catabolism | SOT | lo | polyol transporter 5 (characterized) | 32% | 84% | 233.8 | Arabinose/xylose transporter, AraE | 73% | 661.0 |
| D-fructose catabolism | Slc2a5 | lo | The fructose/xylose:H+ symporter, PMT1 (polyol monosaccharide transporter-1). Also transports other substrates at lower rates. PMT2 is largely of the same sequence and function. Both are present in pollen and young xylem cells (Klepek et al., 2005). A similar ortholog has been identifed in pollen grains of Petunia hybrida (characterized) | 31% | 89% | 217.2 | Arabinose/xylose transporter, AraE | 73% | 661.0 |
| sucrose catabolism | Slc2a5 | lo | The fructose/xylose:H+ symporter, PMT1 (polyol monosaccharide transporter-1). Also transports other substrates at lower rates. PMT2 is largely of the same sequence and function. Both are present in pollen and young xylem cells (Klepek et al., 2005). A similar ortholog has been identifed in pollen grains of Petunia hybrida (characterized) | 31% | 89% | 217.2 | Arabinose/xylose transporter, AraE | 73% | 661.0 |
| trehalose catabolism | TRET1 | lo | Facilitated trehalose transporter Tret1-2 homolog; DmTret1-2 (characterized) | 32% | 84% | 206.1 | Arabinose/xylose transporter, AraE | 73% | 661.0 |
| D-fructose catabolism | STP6 | lo | sugar transport protein 6 (characterized) | 32% | 79% | 198.4 | Arabinose/xylose transporter, AraE | 73% | 661.0 |
| D-galactose catabolism | galP | lo | sugar transport protein 6 (characterized) | 32% | 79% | 198.4 | Arabinose/xylose transporter, AraE | 73% | 661.0 |
| D-mannose catabolism | STP6 | lo | sugar transport protein 6 (characterized) | 32% | 79% | 198.4 | Arabinose/xylose transporter, AraE | 73% | 661.0 |
| sucrose catabolism | STP6 | lo | sugar transport protein 6 (characterized) | 32% | 79% | 198.4 | Arabinose/xylose transporter, AraE | 73% | 661.0 |
| myo-inositol catabolism | HMIT | lo | Probable inositol transporter 2 (characterized) | 35% | 57% | 196.1 | Arabinose/xylose transporter, AraE | 73% | 661.0 |
| D-glucosamine (chitosamine) catabolism | SLC2A2 | lo | Solute carrier family 2, facilitated glucose transporter member 2; Glucose transporter type 2, liver; GLUT-2 (characterized) | 33% | 77% | 186 | Arabinose/xylose transporter, AraE | 73% | 661.0 |
| D-fructose catabolism | frt1 | lo | Fructose:H+ symporter, Frt1 (characterized) | 30% | 78% | 181.4 | Arabinose/xylose transporter, AraE | 73% | 661.0 |
| sucrose catabolism | frt1 | lo | Fructose:H+ symporter, Frt1 (characterized) | 30% | 78% | 181.4 | Arabinose/xylose transporter, AraE | 73% | 661.0 |
Sequence Analysis Tools
View WP_054656487.1 at NCBI
Find papers: PaperBLAST
Find functional residues: SitesBLAST
Search for conserved domains
Find the best match in UniProt
Compare to protein structures
Predict transmenbrane helices: Phobius
Predict protein localization: PSORTb
Find homologs in fast.genomics
Fitness BLAST: loading...
Sequence
MTNEKRIPSWFIYFFGSFGGILFGYDIGVMTGALPFLKIDWNITNASLTGWITSAVMFGA
IFGGALAGQLSDRLGRRKMILISAVIFAVFSLLSGIAPNDGSIYLIIVRIFLGLAVGAAS
ALVPPYMSELAPARLRGRLSGLNQTMIVSGMLISYIMDFVLKGLPTGWGWRVMLAFAAVP
AIILFFGVLRLPESPRFLVKHGDEEAAKRVLSYVRDSQDEIDGELKDIKKTASQETAASK
STHYSTLFTGKYRYLVIAGVGVAAFQQFQGANAIFYYIPLIVEKATGSAASNALMWPIIQ
GVILVLGSLLYMAIAEKFKRRTLIMMGGSVMALSFFLPAIINKMDPNANPMMIVVFLSIY
VAFYSFTWAPLTWVIVGEMFPLAIRGKAAGLASSFNWIGSFAVGLLFPIMTAAMSQEAVF
AIFGAICVLGVLFTHFFVPETKGKTLEEIEAEGTR
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Links
Downloads
Related tools
About GapMind
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using
ublast (a fast alternative to protein BLAST)
against a database of manually-curated proteins (most of which are experimentally characterized) or by using
HMMer with enzyme models (usually from
TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
- ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
- HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.
where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").
Otherwise, a candidate is "medium confidence" if either:
- ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
- ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
- HMMer finds a hit (regardless of coverage or other bits).
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps."
For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways.
For diverse bacteria and archaea that can utilize a carbon source, there is a complete
high-confidence catabolic pathway (including a transporter) just 38% of the time, and
there is a complete medium-confidence pathway 63% of the time.
Gaps may be due to:
- our ignorance of proteins' functions,
- omissions in the gene models,
- frame-shift errors in the genome sequence, or
- the organism lacks the pathway.
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory