Align Putative ABC transporter arginine-binding protein 2 (characterized)
to candidate WP_054653754.1 CES79_RS00810 transporter substrate-binding domain-containing protein
Query= SwissProt::P30859 (243 letters) >NCBI__GCF_002217945.1:WP_054653754.1 Length = 277 Score = 94.0 bits (232), Expect = 3e-24 Identities = 71/232 (30%), Positives = 108/232 (46%), Gaps = 12/232 (5%) Query: 17 ATAAETIRFATEASYPPFESIDA-NNQIVGFDVDLAQALCKEI---DATCTFSNQAFDSL 72 A + TI + +A F +D N+QI GF+VD+A+AL K+I F + Sbjct: 38 AKQSNTITWGVKADTKLFGLMDVKNSQIKGFEVDMAKALTKQILGPKGKADFVQVTSSTR 97 Query: 73 IPSLKFRRVEAVMAGMDITPEREKQVLFTTPYYD-NSALFVGQQGKYTSVDQL--KGKKV 129 +P LK ++A+MA M ITPER KQV F+ Y+D +L V +V L G V Sbjct: 98 MPLLKNGNIDAIMATMTITPERLKQVDFSRSYFDAGQSLLVKNGSPIKNVKDLNKNGATV 157 Query: 130 GVQNGTTHQKFIMDKHPEITTVPYDSYQNAKLDLQNGRIDGVFGDTAVVTEWLKDNPKLA 189 G+ + + P+ + Y A L++G+ + + D ++ +NP Sbjct: 158 LGVVGSNSVQNVAKFAPKAKVLQLSDYAQAMTALKSGQGEALTTDNGILAGMSVENPGYH 217 Query: 190 AVGDKVTDKDYFGTGLGIAVRQGNTELQQKLNTALEKVKKDGTYETIYNKWF 241 G T + Y GIA+ + E + LN AL KV++ G Y I KWF Sbjct: 218 LAGGAFTKEPY-----GIAINKNQPEFKHDLNHALTKVEQSGQYNRILKKWF 264 Lambda K H 0.316 0.133 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 156 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 243 Length of database: 277 Length adjustment: 24 Effective length of query: 219 Effective length of database: 253 Effective search space: 55407 Effective search space used: 55407 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory