Align Putative ABC transporter arginine-binding protein 2 (characterized)
to candidate WP_089136315.1 CES79_RS03445 ABC transporter permease subunit
Query= SwissProt::P30859 (243 letters) >NCBI__GCF_002217945.1:WP_089136315.1 Length = 479 Score = 111 bits (278), Expect = 2e-29 Identities = 71/239 (29%), Positives = 122/239 (51%), Gaps = 12/239 (5%) Query: 5 LIAALIAGFSLSATAAE---TIRFATEASYPPFESIDANNQIVGFDVDLAQALCKEIDAT 61 ++ A+ F L AT A+ T + AT++++PPFE +++N+ VG D+DL A+ K+ Sbjct: 14 ILIAMFITFGLGATPAKATTTYQVATDSTFPPFEFANSHNKYVGIDIDLLHAIAKDQGFK 73 Query: 62 CTFSNQAFDSLIPSLKFRRVEAVMAGMDITPEREKQVLFTTPYYDNSALFVGQ-QGKYTS 120 +F+S + S++ + + V+AGM IT ERE F+ PY+ + + + GK T Sbjct: 74 VNIKPTSFNSAVQSVQSGQADGVIAGMSITKEREATFDFSKPYFMSGVVMAAKPNGKITK 133 Query: 121 VDQLKGKKVGVQNGTTHQKFIMDKHPE--ITTVPYDSYQNAKLDLQNGRIDGVFGDTAVV 178 + QL+GK+V V+ GT+ ++ H + V +D + D+ G F D+ V+ Sbjct: 134 LSQLRGKRVAVKTGTSGAQYAQSIHKKYGFRIVTFDESNDMYQDVLTGNSAACFEDSPVM 193 Query: 179 TEWLKDNPKLAAVGDKVTDKDYFGTGLGIAVRQG-NTELQQKLNTALEKVKKDGTYETI 236 ++ KL K+ K G AV++G N +L + N L +K +G Y I Sbjct: 194 KYAVRQGTKL-----KIYTKPTLNGPYGFAVKKGHNKKLLRMFNNGLADLKSNGEYARI 247 Lambda K H 0.316 0.133 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 276 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 243 Length of database: 479 Length adjustment: 28 Effective length of query: 215 Effective length of database: 451 Effective search space: 96965 Effective search space used: 96965 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory