Align Basic amino acid uptake transporter, BgtAB (characterized)
to candidate WP_089137055.1 CES79_RS09755 ABC transporter substrate-binding protein/permease
Query= TCDB::Q8YSA2 (501 letters) >NCBI__GCF_002217945.1:WP_089137055.1 Length = 496 Score = 228 bits (582), Expect = 3e-64 Identities = 154/469 (32%), Positives = 250/469 (53%), Gaps = 40/469 (8%) Query: 29 QGKTLRIATEPAFPPFEF-TAQGGNLQ--GFSIDLMNAIASAANLKVNFQSLPFDGIIPA 85 +GK + +AT P +PP+EF ++ G Q G +D+M +A +K+ +S+ F ++ A Sbjct: 49 RGKII-MATSPDYPPYEFQVSKHGKSQVVGMDVDIMKQVAKDLGVKLVVKSMSFSNVLVA 107 Query: 86 LQSRTVDAAISSITITAERAETVAFSRPYFKAGLAIAIRSSNED-ITGFDSLKNKKIAVQ 144 +++ D A+S I T ER ++V FS+ Y+ G + I ++ T SL +K I Q Sbjct: 108 VETGKADVAMSGINPTPERRQSVDFSKIYYNGGQSFLINKTDAGKYTNKASLAHKIIGAQ 167 Query: 145 IGTTGAGKAKS-IPGAQIRSFDSAPLALQELLNNNVDAVINDAP-VTLYAINTGNLQGIK 202 GT AKS IPGA+++ D + L + +DA+ + P Y N +L+ IK Sbjct: 168 TGTLQYNLAKSKIPGAKVKGMDKNTDLVLALKTHKIDALGIETPSAEAYVKNDPDLKMIK 227 Query: 203 VVEKLLTEEYYGIATAQ---NSPYLALINDGLNRVLADGSYSQIYQ---KWFKVEPPSLP 256 L + G A A + +A IN + ++ A G +Q K+ KV Sbjct: 228 SGYNLNKNDT-GSAMALKKGSGTLVAAINKSITKIKAKGLPNQYLAQAGKYMKV------ 280 Query: 257 DKSLYENQTNTHKSGSINLILQFLPTLLQGALVTIQLTILSTVLGLICGTLIALTRLSQF 316 NTH + ++ F +G T+ ++ +S + G++ GT++AL R S+ Sbjct: 281 ---------NTHNTSMMHYWTYFA----KGIEYTLIISAISVIFGVLLGTILALMRFSKS 327 Query: 317 TPARLFARAYVDFFRGTPLLVQIFMIYFGIPALAQQLGFTFNFDRWVAGVIALSVNAAAY 376 + AYV+F RGTPL+VQ+ +YFGI G N ++G+IA+S+N+ AY Sbjct: 328 KLLHAISIAYVEFVRGTPLMVQVMFVYFGI-------GIVVNLPALLSGIIAVSLNSGAY 380 Query: 377 IAEIVRAGIQSIETGQTEAAKSLGLNPWLTMRLVIFPQAFRRMLPPLGNEFISLLKDTSL 436 + EI+R GI S++ GQTEA+ SLGL TMR V+ PQA + + P LGNEF+SL+K++S+ Sbjct: 381 VEEIIRGGINSVDKGQTEASASLGLAKTDTMRFVVLPQALKNIWPALGNEFVSLIKESSI 440 Query: 437 VAVIGFEELFRKGQLIVADNYRAFEIYAAVAIVYLCLTLLASQVLSRLE 485 V++IG +L + ++ AD YR I+Y +T + ++VL+ E Sbjct: 441 VSIIGVTDLIYQLNIVRADTYRGVMPVFVAMIIYFVMTFILTRVLNYFE 489 Lambda K H 0.323 0.137 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 477 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 501 Length of database: 496 Length adjustment: 34 Effective length of query: 467 Effective length of database: 462 Effective search space: 215754 Effective search space used: 215754 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory