Align Gamma-glutamyl-gamma-aminobutyrate hydrolase (EC 3.5.1.94) (characterized)
to candidate WP_054654784.1 CES79_RS01835 gamma-glutamyl-gamma-aminobutyrate hydrolase family protein
Query= reanno::Koxy:BWI76_RS10705 (254 letters) >NCBI__GCF_002217945.1:WP_054654784.1 Length = 246 Score = 107 bits (268), Expect = 2e-28 Identities = 83/228 (36%), Positives = 112/228 (49%), Gaps = 20/228 (8%) Query: 32 LNAIVNAGGVPIALPHALAEPELLSALLPKLDGIYLPGSPSNVQPHLYGENGDEPDADPG 91 + A+V AGGVPI P +PE + L DG+ G ++V P YGE EP G Sbjct: 32 IEAVVKAGGVPIIFPSV--DPEDVGDYLDLFDGVAFLGG-ADVDPTFYGE---EPHEKLG 85 Query: 92 -----RDLLSMALIDAALERRIPIFAICRGLQELVVATGGTLYRRLFEQPEL-LEHREDP 145 RDL + L+ A+ + IF ICRG+Q + GGT+Y+ L E P++ L+H + Sbjct: 86 VTYRKRDLFEIELLKQAVAQGKAIFGICRGMQLINTGLGGTVYQDLSENPDMTLKHNQ-- 143 Query: 146 ELPVEQQYAPSHEVQVQEGGLLSQLIPGCNTFWVNSLHGQGAKTTGPRLRVEARSPDGLA 205 PSH V V L + I G + VNS H Q K L+V AR+ DG+ Sbjct: 144 ---AAAGNMPSHHVSVDPTSRLFK-ITGARPY-VNSRHHQAVKQLATSLKVTARADDGVI 198 Query: 206 EAVSVNDHPFALGVQWHPEWNSSEYALSRMLFEGFITACQNYVAEKQR 253 EA + L VQWHPE +A S+ LF IT + VAE+ R Sbjct: 199 EAFESTANDQILAVQWHPENMYKHHAESKALFADLITRSRK-VAEQTR 245 Lambda K H 0.318 0.137 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 168 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 246 Length adjustment: 24 Effective length of query: 230 Effective length of database: 222 Effective search space: 51060 Effective search space used: 51060 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory