Align PEP1B, component of Uptake system for glutamate and aspartate (characterized)
to candidate WP_054653757.1 CES79_RS00820 amino acid ABC transporter permease
Query= TCDB::A1VZQ3 (250 letters) >NCBI__GCF_002217945.1:WP_054653757.1 Length = 217 Score = 134 bits (337), Expect = 2e-36 Identities = 66/213 (30%), Positives = 126/213 (59%), Gaps = 3/213 (1%) Query: 34 FLDALD--NKDAFINGFIYTLEVSILALLIATIFGTIGGVMATSRFKIIRAYTRIYVELF 91 FLDA N + G T+ VS+++++ + I G+I G++ K++ +++++ Sbjct: 4 FLDAYSWINIHYLLQGLWITVAVSVVSIIGSYILGSILGIIRYVNIKVVSPVIGLFIDII 63 Query: 92 QNVPLVIQIFFLFYALPVLGIRLDIFTIGVLGVGAYHGAYVSEVVRSGILAVPRGQFEAS 151 +N+PL++ IFF ++ LP LG R + + + ++E+VRSGI+AV GQ E + Sbjct: 64 RNLPLLLIIFFTYFGLPNLGFRPSSVWATIFAMTIFESTMIAEIVRSGIVAVDPGQMEGA 123 Query: 152 ASQGFTYIQQMRYIIVPQTIRIILPPMTNQMVNLIKNTSVLLIVGGAELMHSADSYAADY 211 + G TY Q + +II+PQ ++ ++P + +Q ++LIK+TS+ I+ +LMH+A Sbjct: 124 RANGLTYGQALYHIILPQAMKKMIPALVSQFISLIKDTSLATIIVLPDLMHNAQIVYGQN 183 Query: 212 GNY-APAYIFAAVLYFIICYPLAYFAKAYENKL 243 Y P ++ A++YFI+CY L+ +++ E ++ Sbjct: 184 STYILPMFLMIAIMYFIVCYALSVLSRSLERRM 216 Lambda K H 0.328 0.143 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 178 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 250 Length of database: 217 Length adjustment: 23 Effective length of query: 227 Effective length of database: 194 Effective search space: 44038 Effective search space used: 44038 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory