Align Amino acid ABC transporter, permease protein PEB1 (characterized, see rationale)
to candidate WP_054653756.1 CES79_RS00815 amino acid ABC transporter permease
Query= uniprot:A0A0H3PA28 (219 letters) >NCBI__GCF_002217945.1:WP_054653756.1 Length = 212 Score = 118 bits (296), Expect = 7e-32 Identities = 68/204 (33%), Positives = 110/204 (53%), Gaps = 3/204 (1%) Query: 13 LMQGLFLTLKIALATCIISIVFGTFLAITKNYGDRLSKFLAACYIDIFRNTPLLLWMLAA 72 L+QG TL ++ + S++ G+ AI + + + +A YI++FRN PLL+ + Sbjct: 12 LLQGFGQTLLCSVIALVFSLIIGSMFAIFETTPIKALRVIARIYIEVFRNIPLLVITMFF 71 Query: 73 CFVLPVFFGQFPQAFWGTIGFSLYTSSVMAEIIRGGLNSIPKGQFEAAYSQGFGKFFTLF 132 V+P+F + GTIG ++YTS+ +AE +R G+ S+ GQ E A + G + + Sbjct: 72 FVVIPMFITKINGFTAGTIGLTIYTSAFIAETVRSGIQSVDPGQMEGARANGLSFWQAMR 131 Query: 133 YIILPQTFRKIIPALLSQIVTTVKDTAYLAGLGIAELTYNSKTILAKLTSFEEILAMIGV 192 YI+LPQ FR +IP L +Q + VK+++ LA + +L Y I + + IG+ Sbjct: 132 YIVLPQAFRYVIPPLGNQFINLVKNSSVLAFVAGFDLMYQGNVIASDSLNTMSTYICIGI 191 Query: 193 VAGIYFIICFSLSMLVRYYAKKTA 216 +Y II LS +RY KK A Sbjct: 192 ---LYLIITLPLSYWMRYLEKKLA 212 Lambda K H 0.331 0.144 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 152 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 219 Length of database: 212 Length adjustment: 22 Effective length of query: 197 Effective length of database: 190 Effective search space: 37430 Effective search space used: 37430 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory